Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.42
PubTator Score 13.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 3.1e-02
glioblastoma 1.400 6.6e-03
sonic hedgehog group medulloblastoma 2.000 9.6e-07
atypical teratoid/rhabdoid tumor 1.600 4.7e-07
medulloblastoma, large-cell 1.400 9.4e-05
primitive neuroectodermal tumor 1.300 5.8e-04
lung cancer -1.100 7.5e-03
breast carcinoma 1.600 3.3e-03
pediatric high grade glioma 1.300 6.6e-04
posterior fossa group A ependymoma 1.300 6.8e-09
lung adenocarcinoma -1.200 3.9e-07
lung carcinoma -1.700 2.2e-25

Gene RIF (7)

PMID Text
25599384 Genetic analyses in human and mouse models revealed the importance of SLC25A24/Slc25a24 in the regulation of body fat mass and adipogenesis.
24332718 N-terminal EF hands form a self-sequestered compact calmodulin like Ca-sensor in the presence of Ca2+
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15123600 identification of three isoforms of the mitochondrial ATP-Mg/Pi carrier APC1, APC2 and APC3; they are most likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria
15054102 SCaMC-1 is the human orthologue of the rabbit Efinal protein, which was reported to be located in peroxisomes

AA Sequence

MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVN      1 - 70
KDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTM     71 - 140
TVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRT    141 - 210
STAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLT    211 - 280
EEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPN    281 - 350
LLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE    351 - 420
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK                 421 - 477
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25599384 2015 SLC25A24 as a novel susceptibility gene for low fat mass in humans and mice.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24332718 2014 A self-sequestered calmodulin-like Ca²? sensor of mitochondrial SCaMC carrier and its implication to Ca²?-dependent ATP-Mg/P(i) transport.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22015608 2012 SCaMC-1 promotes cancer cell survival by desensitizing mitochondrial permeability transition via ATP/ADP-mediated matrix Ca(2+) buffering.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15123600 2004 Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution.
15054102 2004 Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.