Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.30
PubTator Score 13.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 3.1e-02
atypical teratoid / rhabdoid tumor 1.300 9.2e-05
breast carcinoma 1.600 3.3e-03
glioblastoma 1.200 8.7e-05
group 3 medulloblastoma 1.200 2.3e-02
lung adenocarcinoma -1.200 3.9e-07
lung cancer -1.100 7.5e-03
lung carcinoma -1.700 2.2e-25
medulloblastoma, large-cell 1.400 9.4e-05
pediatric high grade glioma 1.300 6.6e-04
posterior fossa group A ependymoma 1.300 6.8e-09
primitive neuroectodermal tumor 1.300 5.8e-04

Gene RIF (9)

AA Sequence

MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVN      1 - 70
KDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTM     71 - 140
TVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRT    141 - 210
STAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLT    211 - 280
EEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPN    281 - 350
LLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE    351 - 420
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK                 421 - 477
//

Text Mined References (21)

PMID Year Title