Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.52
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-05
astrocytoma -1.100 1.0e-25
Astrocytoma, Pilocytic -1.400 7.5e-08
atypical teratoid / rhabdoid tumor -1.100 1.9e-07
breast carcinoma 1.900 6.1e-05
glioblastoma -1.200 1.0e-08
oligodendroglioma -1.100 2.4e-21
pancreatic cancer -1.700 1.2e-03
Pick disease -1.300 4.8e-04
posterior fossa group B ependymoma -1.100 1.2e-08
primary pancreatic ductal adenocarcinoma -1.533 2.8e-03

Gene RIF (5)

AA Sequence

MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSEGYFGMYRGAA      1 - 70
VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQ     71 - 140
RKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYKGLGATLLRDVPFSVVYFPLFAN    141 - 210
LNQLGRPASEEKSPFYVSFLAGCVAGSAAAVAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEG    211 - 280
PSAFLKGAYCRALVIAPLFGIAQVVYFLGIAESLLGLLQDPQA                               281 - 323
//

Text Mined References (18)

PMID Year Title