Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.82
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 3.1e-02
psoriasis 1.700 1.4e-03
osteosarcoma -2.049 4.2e-07
juvenile dermatomyositis -1.181 3.5e-08
pancreatic ductal adenocarcinoma liver m... -1.140 1.5e-02
Pick disease -1.100 5.0e-05
ovarian cancer 1.500 2.8e-05

Protein-protein Interaction (12)

Gene RIF (10)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23054077 OGC as a model protein for understanding the transport mechanism of mitochondrial carriers.
21500544 OGCP degrades through proteasome and lysosome degradation pathways. The degradation of parkin protein can promote the degradation of OGCP.
21448454 Controlling MISC-1/OGC function allows regulation of mitochondrial morphology and cell survival decisions by the metabolic needs of the cell.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16920706 porphyrin accumulation in mitochondria is mediated by OGC and porphyrins are able to competitively inhibit 2-oxoglutarate uptake into mitochondria
12939596 data provide evidence for a role of the 2-oxoglutarate carrier as a glutathione transporting polypeptide

AA Sequence

MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS      1 - 70
ILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPA     71 - 140
EVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLL    141 - 210
DSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWK    211 - 280
GFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG                                        281 - 314
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23054077 2013 The mitochondrial oxoglutarate carrier: from identification to mechanism.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21500544 2011 [Metabolic pathways of OGCP and the influence of parkin protein on the metabolism of OGCP].
21448454 2011 MISC-1/OGC links mitochondrial metabolism, apoptosis and insulin secretion.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16920706 2006 Porphyrin accumulation in mitochondria is mediated by 2-oxoglutarate carrier.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12939596 2003 Sensitivity of the 2-oxoglutarate carrier to alcohol intake contributes to mitochondrial glutathione depletion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10072597 1998 Assignment of the oxoglutarate carrier gene (SLC20A4) to human chromosome 17p13.3.
9639574 1998 Targeting and assembly of the oxoglutarate carrier: general principles for biogenesis of carrier proteins of the mitochondrial inner membrane.
9110174 1997 Large-scale concatenation cDNA sequencing.
8769314 1996 The mitochondrial oxoglutarate carrier protein contains a disulfide bridge between intramembranous cysteines 221 and 224.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8597574 1996 The formation of a disulfide cross-link between the two subunits demonstrates the dimeric structure of the mitochondrial oxoglutarate carrier.
1457818 1992 Sequences of the human and bovine genes for the mitochondrial 2-oxoglutarate carrier.