Property Summary

NCBI Gene PubMed Count 34
PubMed Score 95.85
PubTator Score 44.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.600 1.7e-02
Astrocytoma, Pilocytic 1.200 4.3e-07
atypical teratoid / rhabdoid tumor 1.300 1.1e-04
ependymoma 1.200 9.0e-09
glioblastoma 1.600 2.9e-06
malignant mesothelioma 1.300 9.8e-06
non-small cell lung cancer 1.001 3.0e-13
pancreatic ductal adenocarcinoma liver m... -1.075 6.1e-03
pediatric high grade glioma 1.200 3.9e-06
primitive neuroectodermal tumor 1.400 2.4e-05
Rheumatoid arthritis -1.200 2.5e-02

Gene RIF (17)

AA Sequence

MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDC      1 - 70
VRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVV     71 - 140
CPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYR    141 - 210
GDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTV    211 - 280
PRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD                                           281 - 311
//

Text Mined References (40)

PMID Year Title