Property Summary

NCBI Gene PubMed Count 27
PubMed Score 17.77
PubTator Score 29.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -3.400 6.5e-03
posterior fossa group A ependymoma -5.400 1.4e-19
oligodendroglioma -2.400 2.2e-02
glioblastoma -4.100 6.4e-06
medulloblastoma -3.300 1.1e-03
atypical teratoid / rhabdoid tumor -5.400 7.0e-12
medulloblastoma, large-cell -3.300 9.3e-04
primitive neuroectodermal tumor -4.800 1.4e-05
pediatric high grade glioma -3.600 1.2e-07
ovarian cancer 1.300 1.4e-08
pituitary cancer 2.500 6.0e-06

Gene RIF (12)

PMID Text
23224872 Functional and structural properties of the NCKX2 Na(+)-Ca (2+)/K (+) exchanger: a comparison with the NCX1 Na (+)/Ca (2+) exchanger.
20231282 identified 31 residues that, when substituted, result in shifts in Na(+) affinity, either toward higher or lower K(m) values when compared with wild type NCKX2 (K(m) for Na(+) 58 mm)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18166528 non-synonymous single nucleotide polymorphism in SLC24A5 alters a residue that is important for NCKX5 and NCKX2 activity
17164249 A regulatory kinetic state of calcium (Ca2+) transport via NCKX2 Na+/Ca2+-K+ exchangers may play a prominent role in regulation of Ca2+ extrusion in cellular environments such as neuronal synapses that experience frequent and dynamic Ca2+ fluxes.
17038313 PKC-mediated activation of NCKX2 is sensitive to mutation of multiple PKC consensus sites via a mechanism that may involve several phosphorylation events
15909993 Several residues in helix H2 of NCKX2 are in the proximity of residues in helices H8 and to aspartate575 in H9; the residues found here are conserved in NCKX1-5 isoforms.
15611132 Charge-removing replacement of Asp(575) by either asparagine or cysteine rendered the mutant NCKX2 proteins independent of K(+), whereas the charge-conservative substitution of Asp(575) to glutamate resulted in a nonfunctional mutant NCKX2 protein
15583008 Glu(188) and Asp(548) are the central residues of a single cation binding pocket that can accommodate both K(+) and Ca(2+). Furthermore, a single set of residues lines a transport pathway for both K(+) and Ca(2+).
15196038 results appear to rule out a critical importance of an intramolecular disulfide linkage in NCKX2 protein synthesis and folding as had been reported before
12525183 This is the first systematic NCKX mutagenesis study in which 96 residues are mutated in the human cone NCKX2 cDNA, and functional consequences of these mutations are measured.
12502543 The oligomeric state of this protein is studied.

AA Sequence

MDLQQSTTITSLEKWCLDESLSGCRRHYSVKKKLKLIRVLGLFMGLVAISTVSFSISAFSETDTQSTGEA      1 - 70
SVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEERRKGAIILHVI     71 - 140
GMIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHSNVGIGTIVG    141 - 210
SAVFNILFVIGMCALFSREILNLTWWPLFRDVSFYIVDLIMLIIFFLDNVIMWWESLLLLTAYFCYVVFM    211 - 280
KFNVQVEKWVKQMINRNKVVKVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLM    281 - 350
IHTLDPLAEELGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTST    351 - 420
DVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQVTFLIVFPIVFPLWITLPDV    421 - 490
RKPSSRKFFPITFFGSITWIAVFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGL    491 - 560
GDMAVSSSVGSNIFDITVGLPLPWLLYTVIHRFQPVAVSSNGLFCAIVLLFIMLLFVILSIALCKWRMNK    561 - 630
ILGFIMFGLYFVFLVVSVLLEDRILTCPVSI                                           631 - 661
//

Text Mined References (28)

PMID Year Title
23517042 2013 Genome-wide association study of body mass index in 23 000 individuals with and without asthma.
23224872 2013 Functional and structural properties of the NCKX2 Na(+)-Ca (2+)/K (+) exchanger: a comparison with the NCX1 Na (+)/Ca (2+) exchanger.
20231282 2010 Residues contributing to the Na(+)-binding pocket of the SLC24 Na(+)/Ca(2+)-K(+) Exchanger NCKX2.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18166528 2008 SLC24A5 encodes a trans-Golgi network protein with potassium-dependent sodium-calcium exchange activity that regulates human epidermal melanogenesis.
17716241 2007 Na+/Ca2+ exchangers: three mammalian gene families control Ca2+ transport.
17446491 2007 Involvement of the potassium-dependent sodium/calcium exchanger gene product NCKX2 in the brain insult induced by permanent focal cerebral ischemia.
17446453 2007 Ionic selectivity of NCKX2, NCKX3, and NCKX4 for monovalent cations at K+-binding site.
17332073 2007 Topologic investigation of the NCKX2 Na+/Ca2+-K+ exchanger alpha-repeats.
17303830 2007 Examining Ca2+ extrusion of Na+/Ca2+-K+ exchangers.
17303823 2007 Structure-function relationships of the NCKX2 Na+/Ca2+-K+ exchanger.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
17172467 2007 Exchangers NCKX2, NCKX3, and NCKX4: identification of Thr-551 as a key residue in defining the apparent K(+) affinity of NCKX2.
17164249 2007 Na+-dependent inactivation of the retinal cone/brain Na+/Ca2+-K+ exchanger NCKX2.
17038313 2006 Protein kinase C-dependent enhancement of activity of rat brain NCKX2 heterologously expressed in HEK293 cells.
15909993 2005 Site-directed disulfide mapping of residues contributing to the Ca2+ and K+ binding pocket of the NCKX2 Na+/Ca2+-K+ exchanger.
15611132 2005 Substitution of a single residue, Asp575, renders the NCKX2 K+-dependent Na+/Ca2+ exchanger independent of K+.
15583008 2005 Residues contributing to the Ca2+ and K+ binding pocket of the NCKX2 Na+/Ca2+-K+ exchanger.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196038 2004 Role of cysteine residues in the NCKX2 Na+/Ca(2+)-K+ Exchanger: generation of a functional cysteine-free exchanger.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12600216 2003 Topology of the retinal cone NCKX2 Na/Ca-K exchanger.
12525183 2003 Scanning mutagenesis of the alpha repeats and of the transmembrane acidic residues of the human retinal cone Na/Ca-K exchanger.
12502543 2002 Studies on the oligomeric state of the sodium/calcium + potassium exchanger NCKX2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10662833 2000 Molecular cloning and functional expression of the potassium-dependent sodium-calcium exchanger from human and chicken retinal cone photoreceptors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.