Property Summary

NCBI Gene PubMed Count 14
PubMed Score 57.09
PubTator Score 36.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.058 5.6e-06
posterior fossa group A ependymoma 1.400 3.0e-08
glioblastoma 1.100 1.3e-04
medulloblastoma, large-cell 1.100 6.8e-04
lung cancer -2.100 4.4e-04
adult high grade glioma 1.100 2.7e-03
group 4 medulloblastoma 1.300 6.0e-04
non primary Sjogren syndrome sicca -1.100 2.8e-02
subependymal giant cell astrocytoma 1.285 2.6e-02

Gene RIF (3)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular solute carrier family 24, member 1 protein (SLC24A1) is identified by yeast two-hybrid screen
20850105 A mutation in SLC24A1 is implicated in autosomal-recessive congenital stationary night blindness.
18976975 Knockdown of solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 (SLC24A1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPIKLASRDLSSE      1 - 70
EMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAKMIPTTTKNNYSPTAAGTERR     71 - 140
KEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMET    141 - 210
SHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNN    211 - 280
LFPPRRVESNSSAHPWGLVGKSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSP    281 - 350
RTSVSAIKTAPAIVWRLAKKPSTAPSTSTTPTVRAKLTMQVHHCVVVKPTPAMLTTPSPSLTTALLPEEL    351 - 420
SPSPSVLPPSLPDLHPKGEYPPDLFSVEERRQGWVVLHVFGMMYVFVALAIVCDEYFVPALGVITDKLQI    421 - 490
SEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGTCSLFSREILNLTWWPLFR    491 - 560
DVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTMKWNKHIEVWVKEQLSRRPVAKVMALEDLSK    561 - 630
PGDGAIAVDELQDNKKLKLPSLLTRGSSSTSLHNSTIRSTIYQLMLHSLDPLREVRLAKEKEEESLNQGA    631 - 700
RAQPQAKAESKPEEEEPAKLPAVTVTPAPVPDIKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETE    701 - 770
EKSGGETQPEGEGETETQGKGEECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGE    771 - 840
AKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLDWPETRQKQAI    841 - 910
YLFLLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAHQVGETIGISEEIMGLTILAA    911 - 980
GTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPVPWLLFSLINGLQPVPVSSNGLFCAIVLLFL    981 - 1050
MLLFVISSIASCKWRMNKILGFTMFLLYFVFLIISVMLEDRIISCPVSV                        1051 - 1099
//

Text Mined References (17)

PMID Year Title
20850105 2010 A mutation in SLC24A1 implicated in autosomal-recessive congenital stationary night blindness.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14770312 2004 The SLC24 Na+/Ca2+-K+ exchanger family: vision and beyond.
12693957 2003 Assembly of retinal rod or cone Na(+)/Ca(2+)-K(+) exchanger oligomers with cGMP-gated channel subunits as probed with heterologously expressed cDNAs.
12600216 2003 Topology of the retinal cone NCKX2 Na/Ca-K exchanger.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12037007 2002 Mutated alleles of the rod and cone Na-Ca+K-exchanger genes in patients with retinal diseases.
10662833 2000 Molecular cloning and functional expression of the potassium-dependent sodium-calcium exchanger from human and chicken retinal cone photoreceptors.
10608890 1999 The retinal rod Na(+)/Ca(2+),K(+) exchanger contains a noncleaved signal sequence required for translocation of the N terminus.
9856482 1998 Chromosomal localization and genomic organization of the human retinal rod Na-Ca+K exchanger.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9478004 1998 cDNA cloning of the human retinal rod Na-Ca + K exchanger: comparison with a revised bovine sequence.
7539424 1995 How does the retinal rod Na-Ca+K exchanger regulate cytosolic free Ca2+?