Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 2.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1136
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Juvenile myoclonic epilepsy 21 4.197 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease -1.899 1.2e-02
active ulcerative colitis -1.663 2.0e-02
adult high grade glioma 1.100 2.3e-03
medulloblastoma, large-cell 1.700 3.7e-05
osteosarcoma 1.085 7.2e-03
ovarian cancer 1.100 4.1e-08

Synonym

Accession Q6PIS1 B7Z512 Q2PYN6 Q96NA6
Symbols E2BP3
SVCT3
Yspl1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSRSPLNPSQLRSVGSQDALAPLPPPAPQNPSTHSWDPLCGSLPWGLSCLLALQHVLVMASLLCVSHLLL      1 - 70
LCSLSPGGLSYSPSQLLASSFFSCGMSTILQTWMGSRLPLVQAPSLEFLIPALVLTSQKLPRAIQTPGNS     71 - 140
SLMLHLCRGPSCHGLGHWNTSLQEVSGAVVVSGLLQGMMGLLGSPGHVFPHCGPLVLAPSLVVAGLSAHR    141 - 210
EVAQFCFTHWGLALLVILLMVVCSQHLGSCQFHVCPWRRASTSSTHTPLPVFRLLSVLIPVACVWIVSAF    211 - 280
VGFSVIPQELSAPTKAPWIWLPHPGEWNWPLLTPRALAAGISMALAASTSSLGCYALCGRLLHLPPPPPH    281 - 350
ACSRGLSLEGLGSVLAGLLGSPMGTASSFPNVGKVGLIQAGSQQVAHLVGLLCVGLGLSPRLAQLLTTIP    351 - 420
LPVVGGVLGVTQAVVLSAGFSSFYLADIDSGRNIFIVGFSIFMALLLPRWFREAPVLFSTGWSPLDVLLH    421 - 490
SLLTQPIFLAGLSGFLLENTIPGTQLERGLGQGLPSPFTAQEARMPQKPREKAAQVYRLPFPIQNLCPCI    491 - 560
PQPLHCLCPLPEDPGDEEGGSSEPEEMADLLPGSGEPCPESSREGFRSQK                        561 - 610
//

Text Mined References (9)

PMID Year Title