Property Summary

NCBI Gene PubMed Count 67
PubMed Score 132.23
PubTator Score 100.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.100 2.3e-03
ependymoma 1.100 1.4e-02
oligodendroglioma 1.900 6.7e-04
psoriasis 1.800 2.8e-26
osteosarcoma 1.473 1.1e-04
chronic lymphosyte leukemia 1.100 2.3e-07
atypical teratoid / rhabdoid tumor -1.100 7.1e-06
medulloblastoma, large-cell -1.300 1.3e-04
sonic hedgehog group medulloblastoma -1.200 1.6e-06
ovarian cancer -1.500 3.4e-10
pituitary cancer 1.500 1.2e-04

Gene RIF (55)

PMID Text
26188149 In title.
25821969 Significant methylation changes in the SLC23A2 and NCOR2 regulatory regions.
25645015 Together, these data clarify previous inconsistencies in the literature andimplicate SVCT2 as the pericyte ascorbate transporter.
25242204 Vitamin C supplementation significantly increases skeletal muscle SVCT2 protein expression.
25102111 ascorbic acid uptake mechanism, kinetics, and regulation by sodium dependent vitamin C transporter (SVCT2) in MDA-MB231, T47D and ZR-75-1 cells.
24815519 polymorphisms in SLC23A1/2 genes influenced ascorbate concentration in aqueous humor and lens nucleus.
24594434 We propose that the mitochondrial localization of SVCT2 is a property shared across cells, tissues, and species.
24401033 Demonstrate that the expression of SVCT2 transporter is significantly down-regulated in human grade 3 osteoarthritic tissues.
23999113 Low SVCT2 transporter is associated with Type I diabetes.
23990905 Genetic variation in the sodium-dependent vitamin C transporter 2 may have a role in acute coronary syndrome in women
23837633 Data suggest that N-terminal and C-terminal sorting signals interact, directly or indirectly, within each gene family (here, SVCT1 and SVCT2) in basolateral targeting of transmembrane proteins to basolateral cell membrane.
23613229 Data show that the mRNA level of svct2 was approximately 600- to 900-fold higher than that of svct1 indicating SVCT2 is a main isoform in fibroblast OUMS-36 cells, and no significant difference in svct2 mRNA and protein between young and old cells.
23401652 confirmed the association between rs1279683 (SLC23A2) and primary open-angle glaucoma
23288661 The novel demonstration of SVCT2-dependent mitochondrial transport of ascorbic acid.
22990596 The functional expression of SVCT2 was detected in HEK293 cells.The kinetic analysis suggested that an ascorbate-dependent mechanism accounts for targeted SVCT2 expression in the developing kidney during medullary epithelial cell differentiation.
22348976 glutathione depletion failed to affect ascorbic acid transport, and SVCT1 and SVCT2 expression in hepatoma cells. Therefore, our data indicate an essential role for glutathione in controlling vitamin C metabolism in rat hepatocytes and rat hepatoma cells
22171153 The rs1279683 single-nucleotide polymorphisms in SLC23A2 was significantly associated with lower plasma concentrations of vitamin C and with higher risk of primary open-angle glaucoma in GG subjects.
21770893 Thus CpG methylation at the upstream USF-binding site functions in establishing and maintaining cell-specific transcription from the CpG-poor SVCT2 exon 1a promoter.
21733302 In patients with hepatocellular cholestasis, primary biliary cirrhosis, haemochromatosis and non-alcoholic steatohepatitis, using real-time RT-PCR, an enhanced hepatic expression of both SLC23A1 and SLC23A2 was found.
21335086 Differential occupancy of transcription factors on the GC-rich consensus sequences in the sodium-dependent vitamin C transporter (SVCT2) exon 1b promoter contributes to the regulation of cell and tissue expression of SVCT2.
20588054 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20471816 hSVCT1 and 2 promoters establish that ascorbic acid uptake by human liver epithelial cells is adaptively regulated and show that transcriptional mechanisms via HNF-1 in the hSVCT1 promoter may, in part, be involved in this regulation.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19926816 both NH(2)- and COOH-terminal sequences are essential for proper localization of hSVCT2, cell surface delivery is dependent on intact microtubules, and peripheral microfilaments regulate insertion and retrieval of hSVCT2 into the plasma membrane
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19346260 SLC23A2 genetic variation alters HPV16-associated HNSCC while also highlighting the important role of citrus exposure in this disease.
19346260 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19243932 common variants in SLC23A2, a gene that directly regulates active transport of ascorbic acid, can impact gastric cancer risk
19243932 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19232538 increased expression during macrophage differentiation
19216494 These results collectively suggested a default apical targeting of SVCT, which is consistent with the evolution-based prediction.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19162177 transports Vitamin C, a vital antioxidant, into the brain
18845575 hSVCT2 protein and mRNA are expressed at higher levels in HepG2 cells and native human liver, and the cloned hSVCT2 promoter has more activity in HepG2 cells.
18791929 For SLC23A2, overall, there was no colorectal adenoma association with haplotypes, but two SNPs located in intron 8 and exon 11 could be associated (odds ratio = 0.49, 95% confidence interval = 0.25-0.95 for haplotype G-C vs. haplotype C-C).
18791929 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 estrogen receptor 1, vitamin C receptors SLC23A1 and SLC23A2, and matrix metalloproteinase MMP3 and MMP9 are associated with susceptibility to lymphoma
18636124 Observational study of gene-disease association. (HuGE Navigator)
18619416 N-Glycosylation is therefore essential for SVCT2 functionality.
18614995 all three proximal tubule segments expressed the transporter but the S3 segment had the highest expression; Ascorbic acid transport in these cells was regulated by a single kinetic component that depended on the sodium concentration, pH and temperature
18247577 The results suggest that uncharged His109 of hSVCT2, directly or indirectly, contributes to substrate binding through the hydrogen bond.
17664139 SVCT1 is responsible for epidermal ascorbic acid supply, whereas SVCT2 mainly facilitates ascorbic acid transport in the dermal compartment
17291984 SVCT2 expression can be regulated at the translational level by ascorbic acid and the redox state.
17092984 SVCT2 mRNA expression in human first-trimester chorionic villi but not in term placental tissue.
17012227 SVCT2 may switch between a number of states with characteristic properties, including an inactive conformation in the absence of Ca(2+)/Mg(2+)
16380174 The promoter functionality of the two genomic regions of the hSVCT2 upstream of these alternative first exons in human Vascular Smooth Muscle Cells was tested.
16357110 Observational study of gene-disease association. (HuGE Navigator)
16357110 Findings link genetic variants in the vitamin C transporter gene SLC23A2 to spontaneous preterm birth.
15993839 Functionally, SVCT1 expression led to more transport activity from the apical membrane, while SVCT2 expression only increased the uptake under the condition when basolateral membrane was exposed.
15921655 SVCT2 mediates the secondary active and concentrative transport of ascorbic acid in human chondrocytes
15340249 Functionally expressed in human endothelial cells and negatively regulated by inflammatory cytokines. May provide new insight into treatment of cardiovascular diseases with ascorbic acid.
15060139 These findings suggest a mechanism of ascorbic acid uptake regulation whereby an alternative sodium-ascorbate cotransporter 2 (SVCT2) gene product inhibits transport through the two known ascorbic acid transporters.

AA Sequence

MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKS      1 - 70
SLAETLDSTGSLDPQRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQL     71 - 140
IGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWKCNTTDVSVANGTAELLHTEHIWYP    141 - 210
RIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLV    211 - 280
LLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTD    281 - 350
ARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIF    351 - 420
VEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGAL    421 - 490
FCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNPLVTGITGIDQVLNVLLTTAMFV    491 - 560
GGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTW    561 - 630
KGLRKSDNSRSSDEDSQATG                                                      631 - 650
//

Text Mined References (71)

PMID Year Title
26188149 2015 Intracellular dehydroascorbic acid inhibits SVCT2-dependent transport of ascorbic acid in mitochondria.
25821969 2015 Methylation levels of SLC23A2 and NCOR2 genes correlate with spinal muscular atrophy severity.
25645015 2015 Ascorbic acid transport in brain microvascular pericytes.
25242204 2014 High-dose vitamin C supplementation increases skeletal muscle vitamin C concentration and SVCT2 transporter expression but does not alter redox status in healthy males.
25102111 2014 Molecular expression and functional activity of vitamin C specific transport system (SVCT2) in human breast cancer cells.
24815519 2014 Polymorphisms in sodium-dependent vitamin C transporter genes and plasma, aqueous humor and lens nucleus ascorbate concentrations in an ascorbate depleted setting.
24594434 2014 Mitochondrial ascorbic acid transport is mediated by a low-affinity form of the sodium-coupled ascorbic acid transporter-2.
24401033 2014 Comparative analysis of sodium coupled vitamin C transporter 2 in human osteoarthritis grade 1 and grade 3 tissues.
23999113 2013 Regulation of vitamin C transporter in the type 1 diabetic mouse bone and bone marrow.
23990905 2013 Variation in the sodium-dependent vitamin C transporter 2 gene is associated with risk of acute coronary syndrome among women.
23837633 2013 The N-terminal basolateral targeting signal unlikely acts alone in the differential trafficking of membrane transporters in MDCK cells.
23613229 2013 Senescence-induced increases in intracellular oxidative stress and enhancement of the need for ascorbic acid in human fibroblasts.
23401652 2013 Effects of polymorphisms in vitamin E-, vitamin C-, and glutathione peroxidase-related genes on serum biomarkers and associations with glaucoma.
23288661 2013 Sodium-dependent transport of ascorbic acid in U937 cell mitochondria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990596 2013 Dynamic expression of the sodium-vitamin C co-transporters, SVCT1 and SVCT2, during perinatal kidney development.
22348976 2012 Essential role of intracellular glutathione in controlling ascorbic acid transporter expression and function in rat hepatocytes and hepatoma cells.
22171153 2011 Association between a SLC23A2 gene variation, plasma vitamin C levels, and risk of glaucoma in a Mediterranean population.
21770893 2011 CpG methylation at the USF-binding site mediates cell-specific transcription of human ascorbate transporter SVCT2 exon 1a.
21733302 2011 Hepatic expression of sodium-dependent vitamin C transporters: ontogeny, subtissular distribution and effect of chronic liver diseases.
21335086 2011 Regulation of the human ascorbate transporter SVCT2 exon 1b gene by zinc-finger transcription factors.
20588054 2009 Vitamin C transporter gene polymorphisms, dietary vitamin C and serum ascorbic acid.
20471816 2011 Promoter analysis of the human ascorbic acid transporters SVCT1 and 2: mechanisms of adaptive regulation in liver epithelial cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19926816 2010 Molecular determinants dictating cell surface expression of the human sodium-dependent vitamin C transporter-2 in human liver cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19379732 2009 Topological studies of hSVCT1, the human sodium-dependent vitamin C transporter and the influence of N-glycosylation on its intracellular targeting.
19346260 2009 Genetic variation in the vitamin C transporter, SLC23A2, modifies the risk of HPV16-associated head and neck cancer.
19243932 2009 Genetic variation in sodium-dependent ascorbic acid transporters and risk of gastric cancer in Poland.
19232538 2009 Macrophage differentiation increases expression of the ascorbate transporter (SVCT2).
19216494 2009 Hierarchal contribution of N- and C-terminal sequences to the differential localization of homologous sodium-dependent vitamin C transporters, SVCT1 and SVCT2, in epithelial cells.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19162177 2009 Vitamin C function in the brain: vital role of the ascorbate transporter SVCT2.
18845575 2008 Mechanisms and regulation of vitamin C uptake: studies of the hSVCT systems in human liver epithelial cells.
18791929 2008 Genetic variation in sodium-dependent vitamin C transporters SLC23A1 and SLC23A2 and risk of advanced colorectal adenoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18619416 2008 N-Glycosylation is required for Na+-dependent vitamin C transporter functionality.
18614995 2008 Differential distribution of the Sodium-vitamin C cotransporter-1 along the proximal tubule of the mouse and human kidney.
18417304 2008 Activity of a sodium-dependent vitamin C transporter (SVCT) in MDCK-MDR1 cells and mechanism of ascorbate uptake.
18247577 2008 Functional role of conserved transmembrane segment 1 residues in human sodium-dependent vitamin C transporters.
17664139 2007 Sodium-dependent vitamin C transporter isoforms in skin: Distribution, kinetics, and effect of UVB-induced oxidative stress.
17291984 2007 Translational control of the ascorbic acid transporter SVCT2 in human platelets.
17092984 2007 Expression and characterization of vitamin C transporter in the human trophoblast cell line HTR-8/SVneo: effect of steroids, flavonoids and NSAIDs.
17012227 2007 Mechanistic insights and functional determinants of the transport cycle of the ascorbic acid transporter SVCT2. Activation by sodium and absolute dependence on bivalent cations.
16380174 2005 Functional analysis of two regulatory regions of the human Na+ -dependent vitamin C transporter 2, SLC23A2, in human vascular smooth muscle cells.
16357110 2006 Genetic variation in the sodium-dependent vitamin C transporters, SLC23A1, and SLC23A2 and risk for preterm delivery.
15993839 2005 Polarized localization of vitamin C transporters, SVCT1 and SVCT2, in epithelial cells.
15921655 2005 Chondrocyte transport and concentration of ascorbic acid is mediated by SVCT2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340249 Functional expression of sodium-dependent vitamin C transporter 2 in human endothelial cells.
15060139 2004 A human sodium-dependent vitamin C transporter 2 isoform acts as a dominant-negative inhibitor of ascorbic acid transport.
14993613 2004 Vitamin C controls the cystic fibrosis transmembrane conductance regulator chloride channel.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11984580 2002 New view at C.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11396616 Vitamin C transport systems of mammalian cells.
10915794 2000 The amino-terminal domain of the B subunit of vacuolar H+-ATPase contains a filamentous actin binding site.
10748165 2000 The B1 subunit of the H+ATPase is a PDZ domain-binding protein. Colocalization with NHE-RF in renal B-intercalated cells.
10631088 2000 Human vitamin C (L-ascorbic acid) transporter SVCT1.
10556521 1999 Cloning and functional characterization of the human sodium-dependent vitamin C transporters hSVCT1 and hSVCT2.
10471399 1999 Human placental sodium-dependent vitamin C transporter (SVCT2): molecular cloning and transport function.
10395795 1999 A human nucleobase transporter-like cDNA (SLC23A1): member of a transporter family conserved from bacteria to mammals.
10331392 1999 A family of mammalian Na+-dependent L-ascorbic acid transporters.
9804989 1998 Molecular characterization of two novel transporters from human and mouse kidney and from LLC-PK1 cells reveals a novel conserved family that is homologous to bacterial and Aspergillus nucleobase transporters.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.