| Tclin | Solute carrier family 22 member 8 |
Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA).
This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, May 2010]
This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, May 2010]
Comments
| Disease | Target Count |
|---|---|
| Influenza | 142 |
| Peripheral Neuropathy | 303 |
| Disease | Target Count |
|---|---|
| Hyperuricemia | 35 |
| Adjunct Treatment to Inhibit Renal Drug Excretion | 3 |
| Articular gout | 11 |
| Chronic gouty arthritis | 4 |
| Disease | Target Count | P-value |
|---|---|---|
| osteosarcoma | 7933 | 3.6e-05 |
| nephrosclerosis | 329 | 5.3e-03 |
| Disease | log2 FC | p |
|---|---|---|
| nephrosclerosis | -2.166 | 5.3e-03 |
| osteosarcoma | 1.514 | 3.6e-05 |
| PMID | Text | |
|---|---|---|
| 26277839 | The putative promoter sequences from hOAT1 (SLC22A6) and hOAT3 (SCL22A8) were cloned into a reporter plasmid. | |
| 25477469 | The high efficacy of bendamustine in treating chronic lymphocytic leukemia might be partly due to the expression of OAT3 in lymphoma cells and the high affinity of bendamustine for this transporter. | |
| 25239859 | PPIs inhibit [(3)H]MTX transport via hOAT3 inhibition. | |
| 24185403 | high capacity p-cresyl sulfate trasnporter | |
| 24042472 | Pemetrexed is a superior substrate to methotrexate for hOAT3. | |
| 23832370 | transport of xanthurenic acid by OAT1 and OAT3 | |
| 23649425 | In HEK293-Flp-In cells, the OAT3-Ile305Phe variant had a lower maximum cefotaxime transport activity, Vmax , [159 +/- 3 nmol*(mg protein)(-1) /min (mean +/- SD)] compared with the reference OAT3 [305 +/- 28 nmol*(mg protein)(-1) /min, (mean +/- SD), p < 0.01]. | |
| 23630107 | The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells. | |
| 22108572 | Both hOAT1 and hOAT3 markedly stimulated the uptake of kynurenic acid into oocytes. | |
| 21945944 | High urine OAT1, OAT3 and OAT4 is associated with severe acute kidney injury. | |
| 21865262 | The data 1) reveal alpha-ketoglutarate as a common high-affinity substrate of NaDC3, OAT1, and OAT3 | |
| 21164499 | Intergenic polymorphism rs10792367 between OAT1 and OAT3 is not associated with hypertension, but appears to be involved in between-individual variations in antihypertensive responses to hydrochlorothiazide. | |
| 20237588 | Interaction of human OAT3 with 2,3-dimercapto-1-propanesulfonic acid (DMPS) determines the effect of human OAT3 on basolateral DMPS uptake in rabbit renal proximal tubules. | |
| 19956635 | Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 19878671 | Angiotensin II inhibited hOAT3 activity through the activation of PKCalpha, which led to an acceleration of hOAT3 endocytosis. | |
| 19343046 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19034961 | The renal expression of OAT1 and OAT3 should be taken into account in order to improve pharmacotherapeutic efficacy and to prevent drug toxicity during the onset of this hepatic disease. | |
| 18414781 | The five regulatory single nucleotide polymorphism(SNP)s of OAT3 identified in nephrectomized patients are unlikely to influence OAT3 mRNA expression or promoter activity. | |
| 17585018 | hOAT3 contributes to the renal uptake of rosuvastatin | |
| 17578901 | Inhibition of renal uptake (via OAT3) and efflux processes (via MRP2 and MRP4) explains the possible sites of drug-drug interaction for methotrexate with probenecid and some NSAIDs, including their glucuronides. | |
| 17556638 | urinary excretion of topotecan hydroxyl acid is accounted for by transport via OAT3, as well as glomerular filtration, in both rats and humans | |
| 17502342 | Both hOAT1 and hOAT3 are responsible for the basolateral uptake of edaravone sulfate in the kidney. | |
| 16793932 | These results indicate that the tissue-specific expression of hOAT3 might be regulated by the concerted effect of genetic (HNF1alpha and HNF1beta) and epigenetic (DNA methylation) factors. | |
| 16648942 | The clustering of OAT genes in the genome raises the possibility that nucleotide polymorphisms in SLC22A6 could also effect SLC22A8 expression, and vice versa. | |
| 16291576 | Observational study of genotype prevalence. (HuGE Navigator) | |
| 16291576 | data suggest that genetic variation in OAT3 may contribute to variation in the disposition of drugs | |
| 14984259 | OAT3 plays an important role for anionic drug secretion in patients with renal diseases; expression levels of drug transporters such as OAT3 may be related to the alteration of renal drug secretion. | |
| 12811365 | Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 12811365 | polymorphisms in the OAT3 gene did not appear to be associated with changes in renal and tubular secretory clearance of pravastatin | |
| 11855680 | elucidation of the molecular mechanism for renal tetracycline transport by human organic anion transporters (hOATs) using proximal tubular cells stably expressing hOATs |
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKP 1 - 70 ERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVL 71 - 140 GDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIM 141 - 210 STALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVA 211 - 280 VFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEE 281 - 350 FGVNLYILQIIFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG 351 - 420 CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAAL 421 - 490 FLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS 491 - 542 //
| PMID | Year | Title | |
|---|---|---|---|
| 26277839 | 2015 | Regulation of Expression of Renal Organic Anion Transporters OAT1 and OAT3 in a Model of Ischemia/Reperfusion Injury. | |
| 25477469 | 2015 | Renal human organic anion transporter 3 increases the susceptibility of lymphoma cells to bendamustine uptake. | |
| 25239859 | 2014 | Proton pump inhibitors inhibit methotrexate transport by renal basolateral organic anion transporter hOAT3. | |
| 24185403 | 2014 | Human organic anion transporters function as a high-capacity transporter for p-cresyl sulfate, a uremic toxin. | |
| 24042472 | 2014 | Characteristics of pemetrexed transport by renal basolateral organic anion transporter hOAT3. | |
| 23832370 | 2013 | Transport of xanthurenic acid by rat/human organic anion transporters OAT1 and OAT3. | |
| 23649425 | 2013 | Reduced renal clearance of cefotaxime in asians with a low-frequency polymorphism of OAT3 (SLC22A8). | |
| 23630107 | 2013 | Precise comparison of protein localization among OCT, OAT, and MATE in human kidney. | |
| 22589738 | 2012 | Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women. | |
| 22108572 | 2012 | Interaction and transport of kynurenic acid via human organic anion transporters hOAT1 and hOAT3. | |
| 21945944 | 2012 | Urinary organic anion transporter protein profiles in AKI. | |
| 21865262 | 2011 | Differential interaction of dicarboxylates with human sodium-dicarboxylate cotransporter 3 and organic anion transporters 1 and 3. | |
| 21164499 | 2011 | Association of intergenic polymorphism of organic anion transporter 1 and 3 genes with hypertension and blood pressure response to hydrochlorothiazide. | |
| 20237588 | 2010 | Organic anion transporter 3 (OAT3) and renal transport of the metal chelator 2,3-dimercapto-1-propanesulfonic acid (DMPS). | |
| 19956635 | 2009 | Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies. | |
| 19878671 | 2010 | Angiotensin II inhibits activity of human organic anion transporter 3 through activation of protein kinase Calpha: accelerating endocytosis of the transporter. | |
| 19343046 | 2009 | Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects. | |
| 19056867 | 2009 | Large-scale proteomics and phosphoproteomics of urinary exosomes. | |
| 19034961 | 2008 | Renal elimination of organic anions in cholestasis. | |
| 18414781 | 2008 | Analysis of regulatory polymorphisms in organic ion transporter genes (SLC22A) in the kidney. | |
| 17585018 | 2007 | The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin. | |
| 17578901 | 2007 | Species difference in the inhibitory effect of nonsteroidal anti-inflammatory drugs on the uptake of methotrexate by human kidney slices. | |
| 17556638 | 2007 | Involvement of rat and human organic anion transporter 3 in the renal tubular secretion of topotecan [(S)-9-dimethylaminomethyl-10-hydroxy-camptothecin hydrochloride]. | |
| 17502342 | 2007 | Human organic anion transporters 1 (hOAT1/SLC22A6) and 3 (hOAT3/SLC22A8) transport edaravone (MCI-186; 3-methyl-1-phenyl-2-pyrazolin-5-one) and its sulfate conjugate. | |
| 16793932 | 2006 | Regulation of the expression of human organic anion transporter 3 by hepatocyte nuclear factor 1alpha/beta and DNA methylation. | |
| 16648942 | 2006 | Analyses of 5' regulatory region polymorphisms in human SLC22A6 (OAT1) and SLC22A8 (OAT3). | |
| 16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. | |
| 16455804 | 2006 | Inhibition of oat3-mediated renal uptake as a mechanism for drug-drug interaction between fexofenadine and probenecid. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 16291576 | 2006 | The human organic anion transporter 3 (OAT3; SLC22A8): genetic variation and functional genomics. | |
| 15846473 | 2005 | Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney. | |
| 15644426 | 2005 | Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8). | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15342556 | 2004 | Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. | |
| 15037815 | 2004 | Human organic anion transporter 4 is a renal apical organic anion/dicarboxylate exchanger in the proximal tubules. | |
| 14984259 | 2004 | Expression levels of renal organic anion transporters (OATs) and their correlation with anionic drug excretion in patients with renal diseases. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 14586168 | 2003 | Human organic anion transporter 3 (hOAT3) can operate as an exchanger and mediate secretory urate flux. | |
| 12811365 | 2003 | Polymorphisms of OATP-C (SLC21A6) and OAT3 (SLC22A8) genes: consequences for pravastatin pharmacokinetics. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11912245 | 2002 | Gene expression levels and immunolocalization of organic ion transporters in the human kidney. | |
| 11855680 | 2002 | Human organic anion transporters mediate the transport of tetracycline. | |
| 10049739 | 1999 | Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3). |
