Property Summary

NCBI Gene PubMed Count 41
PubMed Score 235.28
PubTator Score 122.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -2.166 5.3e-03
osteosarcoma 1.514 3.6e-05

 GWAS Trait (1)

 HCA RNA Cell Line (1)

Gene RIF (30)

PMID Text
26277839 The putative promoter sequences from hOAT1 (SLC22A6) and hOAT3 (SCL22A8) were cloned into a reporter plasmid.
25477469 The high efficacy of bendamustine in treating chronic lymphocytic leukemia might be partly due to the expression of OAT3 in lymphoma cells and the high affinity of bendamustine for this transporter.
25239859 PPIs inhibit [(3)H]MTX transport via hOAT3 inhibition.
24185403 high capacity p-cresyl sulfate trasnporter
24042472 Pemetrexed is a superior substrate to methotrexate for hOAT3.
23832370 transport of xanthurenic acid by OAT1 and OAT3
23649425 In HEK293-Flp-In cells, the OAT3-Ile305Phe variant had a lower maximum cefotaxime transport activity, Vmax , [159 +/- 3 nmol*(mg protein)(-1) /min (mean +/- SD)] compared with the reference OAT3 [305 +/- 28 nmol*(mg protein)(-1) /min, (mean +/- SD), p < 0.01].
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
22108572 Both hOAT1 and hOAT3 markedly stimulated the uptake of kynurenic acid into oocytes.
21945944 High urine OAT1, OAT3 and OAT4 is associated with severe acute kidney injury.
21865262 The data 1) reveal alpha-ketoglutarate as a common high-affinity substrate of NaDC3, OAT1, and OAT3
21164499 Intergenic polymorphism rs10792367 between OAT1 and OAT3 is not associated with hypertension, but appears to be involved in between-individual variations in antihypertensive responses to hydrochlorothiazide.
20237588 Interaction of human OAT3 with 2,3-dimercapto-1-propanesulfonic acid (DMPS) determines the effect of human OAT3 on basolateral DMPS uptake in rabbit renal proximal tubules.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19878671 Angiotensin II inhibited hOAT3 activity through the activation of PKCalpha, which led to an acceleration of hOAT3 endocytosis.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19034961 The renal expression of OAT1 and OAT3 should be taken into account in order to improve pharmacotherapeutic efficacy and to prevent drug toxicity during the onset of this hepatic disease.
18414781 The five regulatory single nucleotide polymorphism(SNP)s of OAT3 identified in nephrectomized patients are unlikely to influence OAT3 mRNA expression or promoter activity.
17585018 hOAT3 contributes to the renal uptake of rosuvastatin
17578901 Inhibition of renal uptake (via OAT3) and efflux processes (via MRP2 and MRP4) explains the possible sites of drug-drug interaction for methotrexate with probenecid and some NSAIDs, including their glucuronides.
17556638 urinary excretion of topotecan hydroxyl acid is accounted for by transport via OAT3, as well as glomerular filtration, in both rats and humans
17502342 Both hOAT1 and hOAT3 are responsible for the basolateral uptake of edaravone sulfate in the kidney.
16793932 These results indicate that the tissue-specific expression of hOAT3 might be regulated by the concerted effect of genetic (HNF1alpha and HNF1beta) and epigenetic (DNA methylation) factors.
16648942 The clustering of OAT genes in the genome raises the possibility that nucleotide polymorphisms in SLC22A6 could also effect SLC22A8 expression, and vice versa.
16291576 Observational study of genotype prevalence. (HuGE Navigator)
16291576 data suggest that genetic variation in OAT3 may contribute to variation in the disposition of drugs
14984259 OAT3 plays an important role for anionic drug secretion in patients with renal diseases; expression levels of drug transporters such as OAT3 may be related to the alteration of renal drug secretion.
12811365 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12811365 polymorphisms in the OAT3 gene did not appear to be associated with changes in renal and tubular secretory clearance of pravastatin
11855680 elucidation of the molecular mechanism for renal tetracycline transport by human organic anion transporters (hOATs) using proximal tubular cells stably expressing hOATs

AA Sequence

MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKP      1 - 70
ERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVL     71 - 140
GDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIM    141 - 210
STALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVA    211 - 280
VFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEE    281 - 350
FGVNLYILQIIFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG    351 - 420
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAAL    421 - 490
FLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS                      491 - 542
//

Text Mined References (43)

PMID Year Title
26277839 2015 Regulation of Expression of Renal Organic Anion Transporters OAT1 and OAT3 in a Model of Ischemia/Reperfusion Injury.
25477469 2015 Renal human organic anion transporter 3 increases the susceptibility of lymphoma cells to bendamustine uptake.
25239859 2014 Proton pump inhibitors inhibit methotrexate transport by renal basolateral organic anion transporter hOAT3.
24185403 2014 Human organic anion transporters function as a high-capacity transporter for p-cresyl sulfate, a uremic toxin.
24042472 2014 Characteristics of pemetrexed transport by renal basolateral organic anion transporter hOAT3.
23832370 2013 Transport of xanthurenic acid by rat/human organic anion transporters OAT1 and OAT3.
23649425 2013 Reduced renal clearance of cefotaxime in asians with a low-frequency polymorphism of OAT3 (SLC22A8).
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22108572 2012 Interaction and transport of kynurenic acid via human organic anion transporters hOAT1 and hOAT3.
21945944 2012 Urinary organic anion transporter protein profiles in AKI.
21865262 2011 Differential interaction of dicarboxylates with human sodium-dicarboxylate cotransporter 3 and organic anion transporters 1 and 3.
21164499 2011 Association of intergenic polymorphism of organic anion transporter 1 and 3 genes with hypertension and blood pressure response to hydrochlorothiazide.
20237588 2010 Organic anion transporter 3 (OAT3) and renal transport of the metal chelator 2,3-dimercapto-1-propanesulfonic acid (DMPS).
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19878671 2010 Angiotensin II inhibits activity of human organic anion transporter 3 through activation of protein kinase Calpha: accelerating endocytosis of the transporter.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034961 2008 Renal elimination of organic anions in cholestasis.
18414781 2008 Analysis of regulatory polymorphisms in organic ion transporter genes (SLC22A) in the kidney.
17585018 2007 The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin.
17578901 2007 Species difference in the inhibitory effect of nonsteroidal anti-inflammatory drugs on the uptake of methotrexate by human kidney slices.
17556638 2007 Involvement of rat and human organic anion transporter 3 in the renal tubular secretion of topotecan [(S)-9-dimethylaminomethyl-10-hydroxy-camptothecin hydrochloride].
17502342 2007 Human organic anion transporters 1 (hOAT1/SLC22A6) and 3 (hOAT3/SLC22A8) transport edaravone (MCI-186; 3-methyl-1-phenyl-2-pyrazolin-5-one) and its sulfate conjugate.
16793932 2006 Regulation of the expression of human organic anion transporter 3 by hepatocyte nuclear factor 1alpha/beta and DNA methylation.
16648942 2006 Analyses of 5' regulatory region polymorphisms in human SLC22A6 (OAT1) and SLC22A8 (OAT3).
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16455804 2006 Inhibition of oat3-mediated renal uptake as a mechanism for drug-drug interaction between fexofenadine and probenecid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16291576 2006 The human organic anion transporter 3 (OAT3; SLC22A8): genetic variation and functional genomics.
15846473 2005 Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney.
15644426 2005 Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15037815 2004 Human organic anion transporter 4 is a renal apical organic anion/dicarboxylate exchanger in the proximal tubules.
14984259 2004 Expression levels of renal organic anion transporters (OATs) and their correlation with anionic drug excretion in patients with renal diseases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14586168 2003 Human organic anion transporter 3 (hOAT3) can operate as an exchanger and mediate secretory urate flux.
12811365 2003 Polymorphisms of OATP-C (SLC21A6) and OAT3 (SLC22A8) genes: consequences for pravastatin pharmacokinetics.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11912245 2002 Gene expression levels and immunolocalization of organic ion transporters in the human kidney.
11855680 2002 Human organic anion transporters mediate the transport of tetracycline.
10049739 1999 Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3).