Property Summary

NCBI Gene PubMed Count 21
PubMed Score 122.75
PubTator Score 40.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 8.8e-07
adult high grade glioma 2148 8.8e-04
Disease Target Count Z-score Confidence
Gout 93 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 8.8e-04
psoriasis -1.700 8.8e-07

Gene RIF (12)

PMID Text
26377792 suggest that OAT2-mediated cGMP uptake does not occur via exchange with monocarboxylates, dicarboxylates, and hydroxyl ions
26230641 Two novel variants in SLC22A17 and SLC22A7 were significantly associated with anthracycline-induced cardiotoxicity.
25904762 the findings revealed the important role of OAT2 in renal secretion and possible reabsorption of creatinine and suggested a molecular basis for potential species difference in the transporter handling of creatinine
24646860 At physiologic creatinine concentrations, specific activity of OAT2 transport was over twofold higher than OCT2 or OCT3, establishing OAT2 as a likely creatinine transporter, challenging the view that creatinine is solely transported by a cationic pathway
23543312 mitochondrial pathways may affect SLC 22A7 function to promote the occurrence of hepatocellular carcinoma
22981274 Benzoic acid and specific 2-oxo acids activate hepatic efflux of glutamate at OAT2
22190696 Transport of the antivirals into human embryonic kidney cells was stimulated 10- to 20-fold by expression of OAT2.
21446918 Expression of rat OAT2 in HEK (human embryonic kidney)-293 cells stimulates accumulation of zwitterion trigonelline; subsequently, orotic acid is identified as an excellent and specific substrate of OAT2 from human.
19854166 results suggest that genetic polymorphisms may not be a significant contributing factor to variations in the hOAT2 expression or hOAT2 transport activity
19343046 Observational study of gene-disease association. (HuGE Navigator)
18216183 hOAT2 is a highly efficient, facilitative transporter of cGMP and may be involved in cGMP signaling in many tissues.
11855680 elucidation of the molecular mechanism for renal tetracycline transport by human organic anion transporters (hOATs) using proximal tubular cells stably expressing hOATs

AA Sequence

MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLP      1 - 70
REPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ     71 - 140
KGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALA    141 - 210
GFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPE    211 - 280
SARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCC    281 - 350
VVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR    351 - 420
LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVW    421 - 490
LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEEMPMKQVQN                491 - 548
//

Text Mined References (26)

PMID Year Title
26377792 2015 Human organic anion transporter 2 is distinct from organic anion transporters 1 and 3 with respect to transport function.
26230641 2015 Genetic variants in SLC22A17 and SLC22A7 are associated with anthracycline-induced cardiotoxicity in children.
25904762 2015 Characterization of Organic Anion Transporter 2 (SLC22A7): A Highly Efficient Transporter for Creatinine and Species-Dependent Renal Tubular Expression.
24646860 2014 Contribution of the organic anion transporter OAT2 to the renal active tubular secretion of creatinine and mechanism for serum creatinine elevations caused by cobicistat.
23543312 2014 Mitochondrial metabolism in the noncancerous liver determine the occurrence of hepatocellular carcinoma: a prospective study.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22981274 2013 Benzoic acid and specific 2-oxo acids activate hepatic efflux of glutamate at OAT2.
22190696 2012 Expression of organic anion transporter 2 in the human kidney and its potential role in the tubular secretion of guanine-containing antiviral drugs.
21446918 2011 OAT2 catalyses efflux of glutamate and uptake of orotic acid.
19854166 2010 Identification of genetic polymorphisms of human OAT1 and OAT2 genes and their relationship to hOAT2 expression in human liver.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18216183 2008 Organic anion transporter 2 (SLC22A7) is a facilitative transporter of cGMP.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15901346 2005 Transport mechanism and substrate specificity of human organic anion transporter 2 (hOat2 [SLC22A7]).
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12023506 2002 Interaction of human organic anion transporters 2 and 4 with organic anion transport inhibitors.
11907186 2002 Human organic anion transporters and human organic cation transporters mediate renal transport of prostaglandins.
11855680 2002 Human organic anion transporters mediate the transport of tetracycline.
11327718 2001 Isolation of a family of organic anion transporters from human liver and kidney.
10773670 2000 Assignment of liver-specific organic anion transporter (SLC22A7) to human chromosome 6 bands p21.2-->p21.1 using radiation hybrids.
9650585 1998 Identification of multispecific organic anion transporter 2 expressed predominantly in the liver.