Property Summary

NCBI Gene PubMed Count 61
PubMed Score 196.43
PubTator Score 185.47

Knowledge Summary

Patent

No data available

Gene RIF (46)

PMID Text
25354943 OAT1 and NaDC3 in the basolateral membrane and OAT4 in the luminal membrane of proximal tubule cells are responsible for the avid renal secretion of N-carbamoylglutamate.
25234312 BCL6 constitutes a promising candidate gene for the regulation of human OAT1 transcription
24530383 Clopidogrel/clopidogrel carboxylate are weak inhibitors of OAT1.
24185403 high capacity p-cresyl sulfate trasnporter
23832370 transport of xanthurenic acid by OAT1 and OAT3
23640180 PKC isoform PKCalpha was responsible for OAT1 ubiquitination.
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
23255614 It was shown that human OAT3 and OAT1 cannot be involved in the renal extraction of glutathione from blood, but OAT1 could support intracellular glutathione synthesis by taking up cysteinyl glycine.
22108572 Both hOAT1 and hOAT3 markedly stimulated the uptake of kynurenic acid into oocytes.
21945944 High urine OAT1 and OAT3 and low OAT4 is associated with early reversible proximal tubular damage.
21865262 The data reveal alpha-ketoglutarate as a common high-affinity substrate of NaDC3, OAT1, and OAT3
21164499 Intergenic polymorphism rs10792367 between OAT1 and OAT3 is not associated with hypertension, but appears to be involved in between-individual variations in antihypertensive responses to hydrochlorothiazide.
19892921 Our results are the first to highlight the central role of TM 12 in maintaining the stability and in promoting the maturation efficiency of hOAT1.
19854166 results suggest that genetic polymorphisms may not be a significant contributing factor to variations in the hOAT2 expression or hOAT2 transport activity
19403644 OAT1 appears to be one of the major contributors to renal basolateral uptake of citrulline, and impaired activities of these transporters may contribute substantially to the increase in plasma citrulline in renal failure.
19400747 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19308960 Observational study of gene-disease association. (HuGE Navigator)
19088254 ANG II inhibited hOAT1 activity through activation of PKCalpha, which led to the redistribution of the transporter from the cell surface to the intracellular compartments.
19082692 Gaboxadol could be taken up into the kidney by hOAT1 followed by glucuronidation and efflux of the conjugate into urine via MRP4.
19034961 The renal expression of OAT1 and OAT3 should be taken into account in order to improve pharmacotherapeutic efficacy and to prevent drug toxicity during the onset of this hepatic disease.
18818201 OAT1 undergoes constitutive and protein kinase C-regulated trafficking through a dynamin- and clathrin-dependent pathway
18365245 The data provide a model for the concerted action of OAT1 mediating basolateral secretion of glutarate derivatives from proximal tubule cells
17585018 hOAT1 did not mediate rosuvastatin uptake
17502342 Both hOAT1 and hOAT3 are responsible for the basolateral uptake of edaravone sulfate in the kidney.
17353191 it is concluded that Arg(466) influences the binding of glutarate, but not interaction with p-aminohippurate, and interacts with chloride, which is a major determinant in substrate translocation
17344191 this paper reports the first characterization of the human OAT1 promoter and the first gene in the kidney whose promoter activity is regulated by HNF-4alpha
17038320 identified two new residues, Tyr(230) and Phe(438), which are important for substrate/protein interactions
16920720 the C terminus of hOAT1 has a central role in its function
16648942 The clustering of OAT genes in the genome raises the possibility that nucleotide polymorphisms in SLC22A6 could also effect SLC22A8 expression, and vice versa.
16164645 CH(3)Hg-Cys is transported by hOAT1
16046403 hOAT1 exists in the plasma membrane as a homooligomer, possibly trimer, and higher order of oligomer
15914676 Observational study of genotype prevalence. (HuGE Navigator)
15914676 hOAT1 has been suggested as the basis of nephrotoxicity induced by nucleoside phosphonate analogs
15864112 the coding region of OAT1 has low genetic and functional diversity and its variants may not contribute substantially to interindividual differences in renal elimination of xenobiotics
15284288 mercuric conjugates of Hcy are potential transportable substrates of OAT1.
15200431 Organic anion transporter(s) likely play prominent role in basolateral transport of mercuric ions by proximal tubular cells and in nephropathy induced by Hg(2+).
15145940 Leu-30 and Thr-36 in transmembrane domain 1 are critical determinants of hOAT1 function
15039295 "...provide evidence for a general expression of the recently identified splice-variants of hOTA1...Their expression is restricted to the kidney cortex." p. 430
14984259 The level of human OAT1 mRNA is significantly lower in the kidney of patients with renal diseases than in the normal controls.
14749323 glycosylation has a role in the targeting of OAT1 onto the plasma membrane
14644751 stimulation of basolateral organic anion uptake by EGF or PGE2 is a widespread (if not general) regulatory mechanism, and the signal transduction pathway involved seems to be general
12874449 PKC-induced hOAT1 downregulation is achieved through carrier retrieval from the cell membrane and does not involve phosphorylation of the predicted classic hOAT1 PKC consensus sites
12472777 hOAT1 transports urate,and is not responsible for familial juvenile gouty nephropathy in the two sisters examined in this study.
12429554 cimetidine was found to be substrate for fROAT/hOAT1; organic anion transporters likely contribute to cimetidine excretion in proximal tubules
11855680 elucidation of the molecular mechanism for renal tetracycline transport by human organic anion transporters (hOATs) using proximal tubular cells stably expressing hOATs

AA Sequence

MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRD      1 - 70
RQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLAQSL     71 - 140
YMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGISLNCMTLN    141 - 210
VEWMPIHTRACVGTLIGYVYSLGQFLLAGVAYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGR    211 - 280
LDLTLRALQRVARINGKREEGAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATS    281 - 350
FAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS    351 - 420
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIY    421 - 490
GAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQEK    491 - 560
NGL                                                                       561 - 563
//

Text Mined References (67)

PMID Year Title
25354943 2014 Transporters involved in renal excretion of N-carbamoylglutamate, an orphan drug to treat inborn n-acetylglutamate synthase deficiency.
25234312 2014 Transcriptional regulation of human organic anion transporter 1 by B-cell CLL/lymphoma 6.
24530383 2014 In vitro interaction of clopidogrel and its hydrolysate with OCT1, OCT2 and OAT1.
24185403 2014 Human organic anion transporters function as a high-capacity transporter for p-cresyl sulfate, a uremic toxin.
23832370 2013 Transport of xanthurenic acid by rat/human organic anion transporters OAT1 and OAT3.
23640180 2013 Three ubiquitination sites of organic anion transporter-1 synergistically mediate protein kinase C-dependent endocytosis of the transporter.
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23255614 2013 Human organic anion transporter OAT1 is not responsible for glutathione transport but mediates transport of glutamate derivatives.
22169006 2012 Liver X receptor activation downregulates organic anion transporter 1 (OAT1) in the renal proximal tubule.
22108572 2012 Interaction and transport of kynurenic acid via human organic anion transporters hOAT1 and hOAT3.
21945944 2012 Urinary organic anion transporter protein profiles in AKI.
21865262 2011 Differential interaction of dicarboxylates with human sodium-dicarboxylate cotransporter 3 and organic anion transporters 1 and 3.
21164499 2011 Association of intergenic polymorphism of organic anion transporter 1 and 3 genes with hypertension and blood pressure response to hydrochlorothiazide.
19892921 2010 Putative transmembrane domain 12 of the human organic anion transporter hOAT1 determines transporter stability and maturation efficiency.
19854166 2010 Identification of genetic polymorphisms of human OAT1 and OAT2 genes and their relationship to hOAT2 expression in human liver.
19403644 2009 Organic anion transporter OAT1 is involved in renal handling of citrulline.
19400747 2009 Predictors of kidney tubular dysfunction in HIV-infected patients treated with tenofovir: a pharmacogenetic study.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19308960 2010 Linkage disequilibrium mapping of the chromosome 6q21-22.31 bipolar I disorder susceptibility locus.
19088254 2009 Regulation of human organic anion transporter 1 by ANG II: involvement of protein kinase Calpha.
19082692 2009 Metabolism and renal elimination of gaboxadol in humans: role of UDP-glucuronosyltransferases and transporters.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034961 2008 Renal elimination of organic anions in cholestasis.
18818201 2008 Organic anion transporter OAT1 undergoes constitutive and protein kinase C-regulated trafficking through a dynamin- and clathrin-dependent pathway.
18365245 2008 Organic anion transporters OAT1 and OAT4 mediate the high affinity transport of glutarate derivatives accumulating in patients with glutaric acidurias.
17585018 2007 The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin.
17502342 2007 Human organic anion transporters 1 (hOAT1/SLC22A6) and 3 (hOAT3/SLC22A8) transport edaravone (MCI-186; 3-methyl-1-phenyl-2-pyrazolin-5-one) and its sulfate conjugate.
17353191 2007 The chloride dependence of the human organic anion transporter 1 (hOAT1) is blunted by mutation of a single amino acid.
17344191 2007 Hepatocyte nuclear factor-4{alpha} regulates the human organic anion transporter 1 gene in the kidney.
17038320 2006 A three-dimensional model of human organic anion transporter 1: aromatic amino acids required for substrate transport.
16920720 2006 Functional role of the C terminus of human organic anion transporter hOAT1.
16648942 2006 Analyses of 5' regulatory region polymorphisms in human SLC22A6 (OAT1) and SLC22A8 (OAT3).
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16164645 2005 Handling of cysteine S-conjugates of methylmercury in MDCK cells expressing human OAT1.
16164626 2005 Analyses of coding region polymorphisms in apical and basolateral human organic anion transporter (OAT) genes [OAT1 (NKT), OAT2, OAT3, OAT4, URAT (RST)].
16046403 2005 Human organic anion transporter hOAT1 forms homooligomers.
16024787 2005 IRIP, a new ischemia/reperfusion-inducible protein that participates in the regulation of transporter activity.
15914676 2005 Functional consequences of single nucleotide polymorphisms in the human organic anion transporter hOAT1 (SLC22A6).
15864112 2005 Functional analysis of polymorphisms in the organic anion transporter, SLC22A6 (OAT1).
15846473 2005 Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney.
15644426 2005 Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284288 2004 Homocysteine and the renal epithelial transport and toxicity of inorganic mercury: role of basolateral transporter organic anion transporter 1.
15200431 2004 Human organic anion transporter 1 mediates cellular uptake of cysteine-S conjugates of inorganic mercury.
15145940 2004 Critical amino acid residues in transmembrane domain 1 of the human organic anion transporter hOAT1.
15039295 2004 Expression studies and functional characterization of renal human organic anion transporter 1 isoforms.
15037815 2004 Human organic anion transporter 4 is a renal apical organic anion/dicarboxylate exchanger in the proximal tubules.
14984259 2004 Expression levels of renal organic anion transporters (OATs) and their correlation with anionic drug excretion in patients with renal diseases.
14749323 2004 Role of glycosylation in the organic anion transporter OAT1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14644751 2004 Action of EGF and PGE2 on basolateral organic anion uptake in rabbit proximal renal tubules and hOAT1 expressed in human kidney epithelial cells.
12874449 2003 Protein kinase C activation downregulates human organic anion transporter 1-mediated transport through carrier internalization.
12538807 2003 Interaction of cysteine conjugates with human and rabbit organic anion transporter 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12472777 2003 Urate transport via human PAH transporter hOAT1 and its gene structure.
12429554 2003 Transport of cimetidine by flounder and human renal organic anion transporter 1.
11855680 2002 Human organic anion transporters mediate the transport of tetracycline.
10964714 2000 Genomic structure and in vivo expression of the human organic anion transporter 1 (hOAT1) gene.
10462545 1999 The antiviral nucleotide analogs cidofovir and adefovir are novel substrates for human and rat renal organic anion transporter 1.
10049739 1999 Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3).
9950961 1999 Cloning of the human kidney PAH transporter: narrow substrate specificity and regulation by protein kinase C.
9887087 1999 Molecular cloning and functional expression of a multispecific organic anion transporter from human kidney.
9762842 1998 Cloning of a human renal p-aminohippurate transporter, hROAT1.