Property Summary

NCBI Gene PubMed Count 155
PubMed Score 297.12
PubTator Score 232.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
osteosarcoma 7766 8.6e-06
colon cancer 1428 6.0e-05
interstitial cystitis 2237 3.2e-04
psoriasis 6514 3.6e-04
active ulcerative colitis 736 4.8e-03
active Crohn's disease 882 4.2e-02
Disease Target Count Z-score Confidence
Asthma 370 0.0 2.4
Disease Target Count
Renal carnitine transport defect 1

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.000 6.9e-07
active Crohn's disease -1.156 4.2e-02
active ulcerative colitis -1.768 4.8e-03
colon cancer -1.600 6.0e-05
interstitial cystitis -1.500 3.2e-04
osteosarcoma -1.659 8.6e-06
psoriasis -1.800 3.6e-04

Protein-protein Interaction (1)

Gene RIF (139)

AA Sequence

MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSSAWRNHTVPLR      1 - 70
LRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDW     71 - 140
KAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISN    141 - 210
YVAAFVLGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPES    211 - 280
PRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIML    281 - 350
WMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQLV    351 - 420
PPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFL    421 - 490
PYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKSTAF       491 - 557
//

Text Mined References (165)

PMID Year Title