Property Summary

NCBI Gene PubMed Count 70
PubMed Score 111.27
PubTator Score 85.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (52)

PMID Text
25920679 Findings suggest that OCT3 plays an important role in the absorption and elimination of metformin and that the transporter is a critical determinant of metformin bioavailability, clearance, and pharmacologic action.
25883089 Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation.
25561729 Findings suggest a negative feedback mechanism against inflammatory response by which solute carrier family 22 member 3 (SLC22A3) variant rs3088442 G-->A decreased the risk of coronary heart disease (CHD).
25322669 The markers of EMT were detected by using Western blot.
24471494 Cultured astroctye line 1321N1 and primary human astrocytes transport monoamines partly through OCT3.
23555006 There was no association between rs7758229 in 6q26-q27/SLC22A3 and the risk of colorectal cancer in a Chinese population.
23303678 Decreasing expression of OCT3 and MATE1 in human placenta indicates these transporters may play a role in fetal protection preferentially at earlier stages of gestation.
23071104 The increased Wnt3 in the trastuzumab-resistant cells also promoted a partial EMT-like transition.
23036009 The risk for coronary artery disease in a Chinese Han population is not associated with single nucleotide polymorphisms in the SLC22A3-LPAL2-LPA gene cluster.
22741436 PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C) and NKX3-1 (rs1512268,A) SNPs might not be associated with prostate cancer in Chinese men.
22730461 NUDT11, HNF1B, and SLC22A3 genes have roles in prostate cancer pathogenesis
22231567 Our studies demonstrate that genetic polymorphisms in the proximal promoter region of OCT3 alter the transcription rate of the gene and may be associated with altered expression levels of OCT3 in human liver.
21905038 OCT3 overexpression significantly increased cisplatin cellular accumulation and cytotoxicity in KB-3-1 cells.
21697722 SLC22A3 was expressed high in the human heart with strongest OCT3 immunoreactivity in vascular endothelial cells. SLC22A3/OCT3 expression was not changed in failing human left ventricular myocardium
21636115 evidence for a new means of downregulating IL-4 production by basophils, both in vitro and in vivo, through OCT3 targeted by 5-HT and pharmacologic ligands.
21071540 Observational study of gene-disease association. (HuGE Navigator)
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20717903 Observational study of gene-disease association. (HuGE Navigator)
20690139 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20562519 Genetic association studies indicate 5 SNPs are associated with reduced transport activity of OCT3 (using 5-HT & MPP).
20460480 Observational study of gene-disease association. (HuGE Navigator)
20450899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20429798 There was no clear association between the SLC22A1, SLC22A2, and SLC22A3 genes and diabetic nephropathy or hypertension
20429798 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20371711 The influence of organic cation transporters 1, 2, and 3 (OCT1, OCT2, and OCT3) and their genetic variants on cellular uptake of picoplatin and on the individual components of the ensuing cytotoxicity such as DNA adduct formation, was determined.
19902474 Observational study of gene-disease association. (HuGE Navigator)
19900942 Observational study of gene-disease association. (HuGE Navigator)
19866473 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19591196 Cholestasis and genetic variants are critical determinants for considerable interindividual variability of hepatic OCT1 and OCT3 expression in human liver.
19591196 Observational study of gene-disease association. (HuGE Navigator)
19549807 Observational study of gene-disease association. (HuGE Navigator)
19423541 Observational study of gene-disease association. (HuGE Navigator)
19366831 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19318432 Observational study of gene-disease association. (HuGE Navigator)
19219857 Observational study of gene-disease association. (HuGE Navigator)
19198611 Identification of the SLC22A3-LPAL2-LPA gene cluster as a strong susceptibility locus for coronary artery disease.
19198611 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18794092 Observational study of gene-disease association. (HuGE Navigator)
18295396 We conclude that the proliferation of immature germ cells in GB may be due to an interaction between OCT3/4 and accumulated beta-catenin in the nuclei of the immature germ cells.
18253050 Confirm the usefulness of Caki-1 cells as a proximal tubule model system for investigations of OCT3.
17477885 rare mutations in the EMT gene suggest a causative or modulating role in genetic subtypes of obsessive-compulsive disorder
17393420 PMAT, EMT, and OCT2 transporters are expressed in the endometrial stroma and can potentially regulate reuptake of monoamines in general and histamine in particular.
17010131 Observational study of gene-disease association. (HuGE Navigator)
17010131 These results suggest that polymorphisms of SLC22A3 are related to the development of polysubstance use in Japanese patients with methamphetamine (MAP) dependence.
16141367 Ranitidine and famotidine elicited differential inhibitory activities on SLC22A3.
15135235 organic cation transporter EMT mRNA was mainly detected in the intra lobular septa and also expressed in scattered cells of placental vessel adventitias with lower expression of EMT mRNAs in pre-eclamptic placentae
14690517 EMT is expressed in the area postrema of rat brain and may play a role in physiological functions of this circumventricular organ such as emesis, food intake and the regulation of cardiovascular functions.
12768439 Genetic variation of EMT was studied in Caucasians.
12538837 EMT efficiently translocates agmatine and must be considered for the control of agmatine levels.
11770002 The regulation of EMT-mediated transport by second-messenger phosphorylation/dephosphorylation mechanisms has been characterized in stably transfected HEK293 cells with tritiated 1-methyl-4-phenylpyridinium as substrate.

AA Sequence

MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALAERCGWSPEEE      1 - 70
WNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTI     71 - 140
VSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYGRIVIYLLSCLGVGVTGVVVAFAPNFPVFVI    141 - 210
FRFLQGVFGKGTWMTCYVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFL    211 - 280
FLLYYWVVPESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKC    281 - 350
TLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA    351 - 420
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFR    421 - 490
LAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHSCKCGRNKKTPVSRSHL        491 - 556
//

Text Mined References (72)

PMID Year Title
25920679 2015 Targeted disruption of organic cation transporter 3 attenuates the pharmacologic response to metformin.
25883089 2015 Functional characterization of the organic cation transporters (OCTs) in human airway pulmonary epithelial cells.
25561729 2015 A solute carrier family 22 member 3 variant rs3088442 G?A associated with coronary heart disease inhibits lipopolysaccharide-induced inflammatory response.
25322669 2014 Down-regulation of miR-140 induces EMT and promotes invasion by targeting Slug in esophageal cancer.
25208887 2014 Genetic variants in PLG, LPA, and SIGLEC 14 as well as smoking contribute to plasma plasminogen levels.
24471494 2014 Predominant role of plasma membrane monoamine transporters in monoamine transport in 1321N1, a human astrocytoma-derived cell line.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23555006 2013 Genetic variant rs7758229 in 6q26-q27 is not associated with colorectal cancer risk in a Chinese population.
23303678 2013 Organic cation transporter 3 (OCT3/SLC22A3) and multidrug and toxin extrusion 1 (MATE1/SLC47A1) transporter in the placenta and fetal tissues: expression profile and fetus protective role at different stages of gestation.
23071104 2012 Expression of Wnt3 activates Wnt/?-catenin pathway and promotes EMT-like phenotype in trastuzumab-resistant HER2-overexpressing breast cancer cells.
23036009 2012 Lack of association between four SNPs in the SLC22A3-LPAL2-LPA gene cluster and coronary artery disease in a Chinese Han population: a case control study.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22741436 2012 [Association of prostate cancer with PDLIM5, SLC22A3 and NKX3-1 in Chinese men].
22730461 2012 Genetic and functional analyses implicate the NUDT11, HNF1B, and SLC22A3 genes in prostate cancer pathogenesis.
22231567 2013 Genetic and epigenetic regulation of the organic cation transporter 3, SLC22A3.
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21905038 2012 Contribution of organic cation transporter 3 to cisplatin cytotoxicity in human cervical cancer cells.
21900290 2012 Genetic variants, plasma lipoprotein(a) levels, and risk of cardiovascular morbidity and mortality among two prospective cohorts of type 2 diabetes.
21697722 2011 Organic cation transporter 3: expression in failing and nonfailing human heart and functional characterization.
21636115 2011 Downregulation of basophil-derived IL-4 and in vivo T(H)2 IgE responses by serotonin and other organic cation transporter 3 ligands.
21493818 2011 Genetic and clinical correlates of early-outgrowth colony-forming units.
21242260 2011 Common variant in 6q26-q27 is associated with distal colon cancer in an Asian population.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20717903 2011 Evidence for an association between prostate cancer and chromosome 8q24 and 10q11 genetic variants in African American men: the Flint Men's Health Study.
20690139 2011 Meta-analysis of genome-wide and replication association studies on prostate cancer.
20562519 2010 Functional analysis of human organic cation transporter OCT3 (SLC22A3) polymorphisms.
20460480 2010 Susceptibility loci associated with prostate cancer progression and mortality.
20450899 2010 Individual and cumulative association of prostate cancer susceptibility variants with clinicopathologic characteristics of the disease.
20429798 2010 Association of the SLC22A1, SLC22A2, and SLC22A3 genes encoding organic cation transporters with diabetic nephropathy and hypertension.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20371711 2010 Organic cation transporters modulate the uptake and cytotoxicity of picoplatin, a third-generation platinum analogue.
19902474 2010 Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
19900942 2009 Prognostic significance of prostate cancer susceptibility variants on prostate-specific antigen recurrence after radical prostatectomy.
19866473 2010 Association of 17 prostate cancer susceptibility loci with prostate cancer risk in Chinese men.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19591196 2009 Expression of organic cation transporters OCT1 (SLC22A1) and OCT3 (SLC22A3) is affected by genetic factors and cholestasis in human liver.
19549807 2009 Prostate cancer risk associated loci in African Americans.
19423541 2009 Established prostate cancer susceptibility variants are not associated with disease outcome.
19366831 2009 Analysis of recently identified prostate cancer susceptibility loci in a population-based study: associations with family history and clinical features.
19318432 2009 Generalizability of associations from prostate cancer genome-wide association studies in multiple populations.
19219857 2009 Genetic association studies of methamphetamine use disorders: A systematic review and synthesis.
19198611 2009 Genome-wide haplotype association study identifies the SLC22A3-LPAL2-LPA gene cluster as a risk locus for coronary artery disease.
19141712 2009 Transport of lamivudine [(-)-beta-L-2',3'-dideoxy-3'-thiacytidine] and high-affinity interaction of nucleoside reverse transcriptase inhibitors with human organic cation transporters 1, 2, and 3.
18794092 2008 Association of prostate cancer risk variants with clinicopathologic characteristics of the disease.
18295396 2008 Participation of OCT3/4 and beta-catenin during dysgenetic gonadal malignant transformation.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
18253050 2008 Caki-1 cells as a model system for the interaction of renally secreted drugs with OCT3.
17477885 2008 Novel mutations of the extraneuronal monoamine transporter gene in children and adolescents with obsessive-compulsive disorder.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17393420 2007 The organic cation transporters (OCT1, OCT2, EMT) and the plasma membrane monoamine transporter (PMAT) show differential distribution and cyclic expression pattern in human endometrium and early pregnancy decidua.
17010131 2006 Association between gene polymorphisms of SLC22A3 and methamphetamine use disorder.
16141367 2005 Differential substrate and inhibitory activities of ranitidine and famotidine toward human organic cation transporter 1 (hOCT1; SLC22A1), hOCT2 (SLC22A2), and hOCT3 (SLC22A3).
16024787 2005 IRIP, a new ischemia/reperfusion-inducible protein that participates in the regulation of transporter activity.
15135235 2004 Norepinephrine transporter (NET), serotonin transporter (SERT), vesicular monoamine transporter (VMAT2) and organic cation transporters (OCT1, 2 and EMT) in human placenta from pre-eclamptic and normotensive pregnancies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690517 2004 The localisation of the extraneuronal monoamine transporter (EMT) in rat brain.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12768439 2003 Genetic variability of the extraneuronal monoamine transporter EMT (SLC22A3).
12538837 2003 Agmatine is efficiently transported by non-neuronal monoamine transporters extraneuronal monoamine transporter (EMT) and organic cation transporter 2 (OCT2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110607 2002 Expression and pharmacological profile of the human organic cation transporters hOCT1, hOCT2 and hOCT3.
11770002 2001 Regulation of human extraneuronal monoamine transporter (hEMT) expressed in HEK293 cells by intracellular second messenger systems.
11682442 2001 Release of non-neuronal acetylcholine from the isolated human placenta is mediated by organic cation transporters.
11129104 2000 Analysis of the gene structure of the human (SLC22A3) and murine (Slc22a3) extraneuronal monoamine transporter.
10966924 2000 Structure, function, and regional distribution of the organic cation transporter OCT3 in the kidney.
10942111 2000 Gene structures of the human non-neuronal monoamine transporters EMT and OCT2.
10196521 1998 Molecular identification of the corticosterone-sensitive extraneuronal catecholamine transporter.
9933568 1999 Cloning of the mouse and human solute carrier 22a3 (Slc22a3/SLC22A3) identifies a conserved cluster of three organic cation transporters on mouse chromosome 17 and human 6q26-q27.
9830022 1998 Identity of the organic cation transporter OCT3 as the extraneuronal monoamine transporter (uptake2) and evidence for the expression of the transporter in the brain.
9632645 1998 Cloning and functional characterization of a potential-sensitive, polyspecific organic cation transporter (OCT3) most abundantly expressed in placenta.