Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.53
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.5e-10
medulloblastoma, large-cell 6241 7.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 7.0e-05
osteosarcoma 2.719 3.5e-10

Gene RIF (2)

AA Sequence

MAFQDLLDQVGGLGRFQILQMVFLIMFNVIVYHQTQLENFAAFILDHRCWVHILDNDTIPDNDPGTLSQD      1 - 70
ALLRISIPFDSNLRPEKCRRFVHPQWKLIHLNGTFPNTSEPDTEPCVDGWVYDQSSFPSTIVTKWDLVCE     71 - 140
SQPLNSVAKFLFMAGMMVGGNLYGHLSDRFGRKFVLRWSYLQLAIVGTCAAFAPTILVYCSLRFLAGAAT    141 - 210
FSIIVNTVLLIVEWITHQFCAMALTLTLCAASIGHITLGSLAFVIRDQCILQLVMSAPCFVFFLFSRWLA    211 - 280
ESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVLKSTMKQELEAAQKKHSLCELLRIPNICKRI    281 - 350
CFLSFVRFASTIPFWGLTLHLQHLGNNVFLLQTLFGAVTLLANCVAPWALNHMSRRLSQMLLMFLLATCL    351 - 420
LAIIFVPQEMQTLRVVLATLGVGAASLGITCSTAQENELIPSIIRGRATGITGNFANIGGALASLMMILS    421 - 490
IYSRPLPWIIYGVFAILSGLVVLLLPETRNQPLLDSIQDVENEGVNSLAAPQRSSVL                 491 - 547
//

Text Mined References (9)

PMID Year Title