Property Summary

NCBI Gene PubMed Count 86
PubMed Score 124.30
PubTator Score 170.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.150 2.1e-02
malignant mesothelioma -4.200 3.5e-09
osteosarcoma 1.000 1.6e-04

Gene RIF (81)

PMID Text
26674735 Seventeen of the variants observed in the SLC22A2 gene of the Xhosa population were specific to/or occurred at a higher frequency in African populations or populations with a recent connection to the African continent.
25883089 Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation.
25823781 We noted a statistically significant association between the nonsynonymous SNP rs316019(SLC22A2) and cisplatin-induced ototoxicity, in that the T allele occurred more frequently in patients who experienced no ototoxicity from cisplatin treatment.
25662675 the loss-of-function variant OCT2-T201M (rs145450955) contribute to changes in insulin resistance and beta cell activity in patients with T2D treated with metformin.
25573751 The 808G>T variant of SLC22A2 improves the metformin long-term glucose-lowering effect in Chinese type 2 diabetics.
25143296 The functional OCT2 Ser270Ala polymorphism is significantly associated with abstinence among treatment-seeking smokers.
25019617 functional amino acid residues involved in polyamine and agmatine transport by human organic cation transporter 2
24643204 The genetic polymorphisms in OCT2, AQP2, AQP9 and TMEM205 may contribute to chemotherapy response in lung cancer patients.
24533710 OCT variants ( OCT1, OCT2 and ATM) were significantly associated with elevated baseline and glucose-induced C-peptide levels in polycystic ovary syndrome
24530383 Clopidogrel/clopidogrel carboxylate are weak inhibitors of OCT2.
24427340 results suggest that high levels of OCT2 indicate severe invasion, but also better prognosis in metastatic colorectal cancer patients treated with oxaliplatin-based chemotherapy
24102360 In chemotherapy for oesophageal cancers, cisplatin-induced nephrotoxicity seems to be unaffected by SLC22A2 polymorphism
23864433 ADMA and L-arginine are substrates of human CAT2A, CAT2B, OCT2 and MATE1. Transport kinetics of CAT2A, CAT2B, and OCT2 indicate a low affinity, high capacity transport, which may be relevant for renal and hepatic elimination of ADMA or L-arginine
23776246 Cellular uptake of oxaliplatin increases by 16- to 35-fold in cells overexpressing OCT2, a process that is associated with increased DNA platination and oxaliplatin-induced cytotoxicity.
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
23545524 hOCT2 does not apperar to contribute significantly to fluoroquinolone disposition.
23424657 expression and prognostic impact of SOX2, OCT4, Nanog and Nestin in nasopharyngeal carcinoma
23341218 SLC22A2 single nucleotide polymorphisms (SNPs), rs3127573 and rs316009, were genotyped in 1,142 ESRD patients receiving renal transplantation. Neither SNP was associated with GF
22913740 Rhodamine 123 is a high-affinity substrate for both hOCT1 and hOCT2.
22875535 The accumulation of lamivudine in CD4 cells of HIV-infected patients is related to the expression of OCT1 and OCT2.
22735389 Seven polymorphisms in OCT1, OCT2, and MATE1 genes were compared between 53 type 2 diabetes patients with side effects of metformin and 193 metformin users without symptoms of metformin intolerance.
22590580 tryptophan can serve as one of the endogenous substrate for the OCT2 as well as a biomarker candidate indicating the variability of the transport activity of OCT2.
22573376 Conserved cysteines in the human organic cation transporter 2 (hOCT2), namely the six cysteines in the long extracellular loop (loop cysteines) and C474 in transmembrane helix 11, are important for plasma membrane targeting.
22569819 The 808G>T single-nucleotide polymorphism in OCT2 ameliorated cisplatin-induced nephrotoxicity without alteration of disposition, whereas the rs2289669 G>A single-nucleotide polymorphism in MATE1 had no effect on cisplatin toxicity.
22525860 results suggested that SLC22A2 gene polymorphism 808 G/T and cimetidine could attenuate cisplatin nephrotoxicity in Chinese cancer patients
22483271 This mini-review discusses structural requirements for both OCT1 and OCT2 versus the blood-brain barrier choline transporter (BBBCHT) are discussed and compared.
22223530 OCT2 plays a decisive role in the renal secretion of creatinine. This process can be inhibited by OCT2 substrates, which impair the usefulness of creatinine as a marker of renal function.
22085643 Data show that the cysteines of the large extracellular loop are important to enable correct folding, oligomeric assembly, and plasma membrane insertion of organic cation transporter 2 (hOCT2).
21553234 hOCT2 interacts with LAPTM4A in lysosomes and late endosomes and regulates endocytotic recruitment.
21346370 Our findings suggest that SLC22A2 could be a susceptibility gene for aspirin intolerance in asthmatics.
21128598 The results suggest that agmatine disposition may be influenced by hOCT2 and hMATE1, two transporters critical in the renal elimination of xenobiotic compounds.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20429798 There was no clear association between the SLC22A1, SLC22A2, and SLC22A3 genes and diabetic nephropathy or hypertension
20429798 Observational study of gene-disease association. (HuGE Navigator)
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20371711 The influence of organic cation transporters 1, 2, and 3 (OCT1, OCT2, and OCT3) and their genetic variants on cellular uptake of picoplatin and on the individual components of the ensuing cytotoxicity such as DNA adduct formation, was determined.
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20067471 The hSLC22A2 drug transporter is a critical determinant in the uptake and cytotoxicity of various platinum compounds, particularly oxaliplatin.
20053795 This study showed that coordinate function of MATE1 with OCT2 likely contributes to the vectorial renal elimination of organic cationic drugs and that altered activity of MATE1 should be considered as a determinant of renal cationic drug elimination.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19833842 YM155 is a substrate for OCT1 and OCT2, whereas it is unlikely for OCT3.
19625999 we found that a nonsynonymous single-nucleotide polymorphism (SNP) in the OCT2 gene SLC22A2 (rs316019) was associated with reduced cisplatin-induced nephrotoxicity in patients
19536068 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19483665 Genetic variation in OCT2 plays an important role in the renal clearance and net secretion of metformin in healthy volunteers.
19483665 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18728938 genetic variants (OCT2-T199I, -T201M, and -A270S) decreased the transport activity of metformin and thus may contribute to the inter-individual variation in metformin disposition
18559608 Known variants in SLC22A2 do not substantially contribute to explaining interindividual pharmacokinetic variability, suggesting that other mechanisms, controlling OCT2 expression, might be involved.
18551044 The 808G>T polymorphism is associated with a reduced metformin renal or tubular clearance.
18551044 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18508876 These results indicate that kidney-specific expression of human OCT2 is regulated by methylation of the proximal promoter region, interfering with the transactivation by USF1.
18414781 Investigation of influences of regulatory single nucleotide polymorphisms (SNPs) of SLC22A in the kidney identifies a regulatory SNP that reduces human OCT2 promoter activity; one (insignificant) deletion polymorphism (-578_-576delAAG) is found.
18401339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17971819 Varenicline was characterized as a moderate-affinity substrate for hOCT2 (K(m)=370 microM) and its hOCT2-mediated uptake was partially inhibited by cimetidine.
17495125 The results suggest that hOCT2 and hMATE1 mediate paraquat transport in the kidney.
17393420 PMAT, EMT, and OCT2 transporters are expressed in the endometrial stroma and can potentially regulate reuptake of monoamines in general and histamine in particular.
17220237 Observational study of genotype prevalence. (HuGE Navigator)
17220237 findings suggest that genetic variants of hOCTs are not linked among three genes in a Korean population, and several of the hOCT genetic variants cause decreased transport activity in vitro compared with the wild type
17111267 Observational study of gene-disease association. (HuGE Navigator)
17060063 Observational study of gene-disease association. (HuGE Navigator)
17060063 This study further suggests a function of OCT2 in blood pressure homeostasis and points to the potential role of the transporter in the development of essential hypertension.
16990275 data demonstrate that cysteine 474 of OCT2 is exposed to the aqueous milieu of the cleft and contributes to forming a pathway for organic cation transport
16951202 OCT1 and OCT2 are major determinants of the anticancer activity of oxaliplatin and may contribute to its antitumor specificity.
16513443 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16368738 N-glycosylation of OCT2 has a profound effect on plasma membrane expression, substrate affinity, and maximum rate of substrate transport
16314463 uptake of cis-platin is mediated by hOCT2 in renal proximal tubules; cis-platin with other substrates that compete for hOCT2 offers an effective option to decrease nephrotoxicity in the clinical setting.
16141367 Ranitidine and famotidine elicited differential inhibitory activities on SLC22A2.
15817714 OCT1 and OCT2 mediate luminal ACh release in human airways
15499192 Observational study of genotype prevalence. (HuGE Navigator)
15135235 organic cation transporter EMT mRNA was mainly detected in the intra lobular septa and together with organic cation transporters OCT1 and OCT2 mRNAs also expressed in scattered cells of placental vessel adventitias
12538837 OCT2 efficiently translocates agmatine and must be considered for the control of agmatine levels.
12388397 inhibited by PI3K and PKA and activated by a CaM-dependent signaling pathway
12142729 polymorphisms in kidney exhibit altered function
12089365 cDNA coding hOCT2-A was isolated from human kidney. an alternatively spliced variant of hOCT2 with an insertion of 1169 bp. open reading frame encodes 483-amino acid protein with 81% amino acid identity with hOCT2.
11953440 The human organic cation transporter (hOCT2) recognizes the degree of substrate ionization
9078256 Oct proteins have been shown to bind to HIV-1 Tat and both enhance and repress Tat-mediated transactivation of the HIV-1 LTR promoter, suggesting a role for Oct proteins in regulation of Tat function
8902060 Oct proteins have been shown to bind to HIV-1 Tat and both enhance and repress Tat-mediated transactivation of the HIV-1 LTR promoter, suggesting a role for Oct proteins in regulation of Tat function
7690421 Oct proteins have been shown to bind to HIV-1 Tat and both enhance and repress Tat-mediated transactivation of the HIV-1 LTR promoter, suggesting a role for Oct proteins in regulation of Tat function
1727476 Oct proteins have been shown to bind to HIV-1 Tat and both enhance and repress Tat-mediated transactivation of the HIV-1 LTR promoter, suggesting a role for Oct proteins in regulation of Tat function

AA Sequence

MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEE      1 - 70
LNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFN     71 - 140
LVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQ    141 - 210
GLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYY    211 - 280
WCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMI    281 - 350
LMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA    351 - 420
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTN    421 - 490
IWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN         491 - 555
//

Text Mined References (99)

PMID Year Title
26674735 2015 Single nucleotide polymorphisms of the SLC22A2 gene within the Xhosa population of South Africa.
25883089 2015 Functional characterization of the organic cation transporters (OCTs) in human airway pulmonary epithelial cells.
25823781 2015 Human OCT2 variant c.808G>T confers protection effect against cisplatin-induced ototoxicity.
25662675 2015 The variant organic cation transporter 2 (OCT2)-T201M contribute to changes in insulin resistance in patients with type 2 diabetes treated with metformin.
25573751 2015 Polymorphism of organic cation transporter 2 improves glucose-lowering effect of metformin via influencing its pharmacokinetics in Chinese type 2 diabetic patients.
25143296 2014 Organic cation transporter variation and response to smoking cessation therapies.
25019617 2014 Identification of functional amino acid residues involved in polyamine and agmatine transport by human organic cation transporter 2.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24643204 2014 The association of transporter genes polymorphisms and lung cancer chemotherapy response.
24533710 2014 Metformin resistance alleles in polycystic ovary syndrome: pattern and association with glucose metabolism.
24530383 2014 In vitro interaction of clopidogrel and its hydrolysate with OCT1, OCT2 and OAT1.
24427340 2014 Organic cation transporter 2 and tumor budding as independent prognostic factors in metastatic colorectal cancer patients treated with oxaliplatin-based chemotherapy.
24102360 2013 Absence of effect of SLC22A2 genotype on cisplatin-induced nephrotoxicity in oesophageal cancer patients receiving cisplatin and 5-fluorouracil: report of results discordant with those of earlier studies.
23864433 2013 Transport of asymmetric dimethylarginine (ADMA) by cationic amino acid transporter 2 (CAT2), organic cation transporter 2 (OCT2) and multidrug and toxin extrusion protein 1 (MATE1).
23776246 2013 Oxaliplatin-induced neurotoxicity is dependent on the organic cation transporter OCT2.
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
23545524 2013 Human organic cation transporters 1 (SLC22A1), 2 (SLC22A2), and 3 (SLC22A3) as disposition pathways for fluoroquinolone antimicrobials.
23424657 2013 Embryonic stem cells markers SOX2, OCT4 and Nanog expression and their correlations with epithelial-mesenchymal transition in nasopharyngeal carcinoma.
23341218 2013 SLC22A2 is associated with tubular creatinine secretion and bias of estimated GFR in renal transplantation.
22913740 2014 The mitochondrial fluorescent dye rhodamine 123 is a high-affinity substrate for organic cation transporters (OCTs) 1 and 2.
22875535 2013 Organic cation transporters OCT1 and OCT2 determine the accumulation of lamivudine in CD4 cells of HIV-infected patients.
22735389 2012 Association of genetic variation in the organic cation transporters OCT1, OCT2 and multidrug and toxin extrusion 1 transporter protein genes with the gastrointestinal side effects and lower BMI in metformin-treated type 2 diabetes patients.
22590580 2012 Pharmacogenetics meets metabolomics: discovery of tryptophan as a new endogenous OCT2 substrate related to metformin disposition.
22573376 2012 Functional significance of conserved cysteines in the human organic cation transporter 2.
22569819 2012 Effects of genetic variants in SLC22A2 organic cation transporter 2 and SLC47A1 multidrug and toxin extrusion 1 transporter on cisplatin-induced adverse events.
22525860 2012 Ameliorative effects of SLC22A2 gene polymorphism 808 G/T and cimetidine on cisplatin-induced nephrotoxicity in Chinese cancer patients.
22483271 2012 The blood-brain barrier choline transporter.
22223530 2012 Proximal tubular secretion of creatinine by organic cation transporter OCT2 in cancer patients.
22085643 2012 The cysteines of the extracellular loop are crucial for trafficking of human organic cation transporter 2 to the plasma membrane and are involved in oligomerization.
21553234 2011 LAPTM4A interacts with hOCT2 and regulates its endocytotic recruitment.
21346370 2011 Possible association of SLC22A2 polymorphisms with aspirin-intolerant asthma.
21128598 2011 OCT2 and MATE1 provide bidirectional agmatine transport.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20429798 2010 Association of the SLC22A1, SLC22A2, and SLC22A3 genes encoding organic cation transporters with diabetic nephropathy and hypertension.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
20371711 2010 Organic cation transporters modulate the uptake and cytotoxicity of picoplatin, a third-generation platinum analogue.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20067471 2010 Differential transport of platinum compounds by the human organic cation transporter hOCT2 (hSLC22A2).
20053795 2010 Human multidrug and toxin extrusion 1 (MATE1/SLC47A1) transporter: functional characterization, interaction with OCT2 (SLC22A2), and single nucleotide polymorphisms.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19833842 2010 Characterization of human organic cation transporter 1 (OCT1/SLC22A1)- and OCT2 (SLC22A2)-mediated transport of 1-(2-methoxyethyl)-2-methyl-4,9-dioxo-3-(pyrazin-2-ylmethyl)- 4,9-dihydro-1H-naphtho[2,3-d]imidazolium bromide (YM155 monobromide), a novel small molecule survivin suppressant.
19625999 2009 Contribution of organic cation transporter 2 (OCT2) to cisplatin-induced nephrotoxicity.
19536068 2009 The effects of genetic polymorphisms in the organic cation transporters OCT1, OCT2, and OCT3 on the renal clearance of metformin.
19483665 2009 Effect of genetic variation in the organic cation transporter 2 on the renal elimination of metformin.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19141712 2009 Transport of lamivudine [(-)-beta-L-2',3'-dideoxy-3'-thiacytidine] and high-affinity interaction of nucleoside reverse transcriptase inhibitors with human organic cation transporters 1, 2, and 3.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18728938 2008 Genetic variants of organic cation transporter 2 (OCT2) significantly reduce metformin uptake in oocytes.
18559608 2008 Interaction of Cisplatin with the human organic cation transporter 2.
18551044 2008 OCT2 polymorphisms and in-vivo renal functional consequence: studies with metformin and cimetidine.
18508876 2008 Kidney-specific expression of human organic cation transporter 2 (OCT2/SLC22A2) is regulated by DNA methylation.
18414781 2008 Analysis of regulatory polymorphisms in organic ion transporter genes (SLC22A) in the kidney.
18401339 2008 Genetic variants of the organic cation transporter 2 influence the disposition of metformin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17971819 2008 Effect of human renal cationic transporter inhibition on the pharmacokinetics of varenicline, a new therapy for smoking cessation: an in vitro-in vivo study.
17582384 2007 Differential contribution of organic cation transporters, OCT2 and MATE1, in platinum agent-induced nephrotoxicity.
17495125 2007 Transport of paraquat by human organic cation transporters and multidrug and toxic compound extrusion family.
17393420 2007 The organic cation transporters (OCT1, OCT2, EMT) and the plasma membrane monoamine transporter (PMAT) show differential distribution and cyclic expression pattern in human endometrium and early pregnancy decidua.
17220237 2007 Identification and functional characterization of genetic variants of human organic cation transporters in a Korean population.
17111267 2007 Human organic cation transporter (OCT1 and OCT2) gene polymorphisms and therapeutic effects of metformin.
17072098 2006 Interactions of fluoroquinolone antibacterials, DX-619 and levofloxacin, with creatinine transport by renal organic cation transporter hOCT2.
17060063 2006 Lower prevalence of the OCT2 Ser270 allele in patients with essential hypertension.
16990275 2006 Cysteine accessibility in the hydrophilic cleft of human organic cation transporter 2.
16951202 2006 Organic cation transporters are determinants of oxaliplatin cytotoxicity.
16914559 2006 Cisplatin and oxaliplatin, but not carboplatin and nedaplatin, are substrates for human organic cation transporters (SLC22A1-3 and multidrug and toxin extrusion family).
16513443 2006 Organic anion transporting polypeptide 1B1 activity classified by SLCO1B1 genotype influences atrasentan pharmacokinetics.
16394027 2006 Characterization of regulatory mechanisms and states of human organic cation transporter 2.
16368738 2006 Functional influence of N-glycosylation in OCT2-mediated tetraethylammonium transport.
16314463 2005 Cisplatin nephrotoxicity is critically mediated via the human organic cation transporter 2.
16272756 2005 Metformin is a superior substrate for renal organic cation transporter OCT2 rather than hepatic OCT1.
16141367 2005 Differential substrate and inhibitory activities of ranitidine and famotidine toward human organic cation transporter 1 (hOCT1; SLC22A1), hOCT2 (SLC22A2), and hOCT3 (SLC22A3).
16024787 2005 IRIP, a new ischemia/reperfusion-inducible protein that participates in the regulation of transporter activity.
16006492 2005 A species difference in the transport activities of H2 receptor antagonists by rat and human renal organic anion and cation transporters.
15817714 2005 Polyspecific cation transporters mediate luminal release of acetylcholine from bronchial epithelium.
15783073 2005 Metformin transport by renal basolateral organic cation transporter hOCT2.
15499192 2004 Fourteen novel single nucleotide polymorphisms in the SLC22A2 gene encoding human organic cation transporter (OCT2).
15496291 2004 Different transport properties between famotidine and cimetidine by human renal organic ion transporters (SLC22A).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15135235 2004 Norepinephrine transporter (NET), serotonin transporter (SERT), vesicular monoamine transporter (VMAT2) and organic cation transporters (OCT1, 2 and EMT) in human placenta from pre-eclamptic and normotensive pregnancies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12538837 2003 Agmatine is efficiently transported by non-neuronal monoamine transporters extraneuronal monoamine transporter (EMT) and organic cation transporter 2 (OCT2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388397 2003 Regulation of human organic cation transporter hOCT2 by PKA, PI3K, and calmodulin-dependent kinases.
12142729 2002 Polymorphisms in a human kidney xenobiotic transporter, OCT2, exhibit altered function.
12089365 2002 cDNA cloning, functional characterization, and tissue distribution of an alternatively spliced variant of organic cation transporter hOCT2 predominantly expressed in the human kidney.
11953440 2002 The human organic cation transporter (hOCT2) recognizes the degree of substrate ionization.
11912245 2002 Gene expression levels and immunolocalization of organic ion transporters in the human kidney.
11758759 2001 Distinct characteristics of organic cation transporters, OCT1 and OCT2, in the basolateral membrane of renal tubules.
11483518 2001 Regulation of BOB.1/OBF.1 stability by SIAH.
11447227 2001 Properties and regulation of organic cation transport in freshly isolated human proximal tubules.
10942111 2000 Gene structures of the human non-neuronal monoamine transporters EMT and OCT2.
9933568 1999 Cloning of the mouse and human solute carrier 22a3 (Slc22a3/SLC22A3) identifies a conserved cluster of three organic cation transporters on mouse chromosome 17 and human 6q26-q27.
9687576 1998 Human neurons express the polyspecific cation transporter hOCT2, which translocates monoamine neurotransmitters, amantadine, and memantine.
9605850 1997 The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26.
9260930 1997 Cloning and characterization of two human polyspecific organic cation transporters.