Property Summary

NCBI Gene PubMed Count 27
PubMed Score 206.17
PubTator Score 32.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (15)

PMID Text
26196590 Establish SLC22A18 as a tumor suppressor in colon epithelial cells and propose that SLC22A18 is potentially a marker of diagnostic and prognostic values.
25498886 microRNA-137 functions as a tumor suppressor in human non-small cell lung cancer by targeting SLC22A18
24481489 Upregulated expression of SLC22A18 enhanced the radiosensitivity of glioma U251 cells.
23514245 SLC22A18 protein expression predicted a significantly shorter overall survival in 51 patients receiving TMZ therapy, whereas no differences in overall survival were observed in 35 patients without TMZ therapy
22237119 The expression level of SLC22A18 in non-small cell lung cancer was significantly higher than that in normal tissue.
22153794 SLC22A18 functions as a tumor suppressor in glioma and represents a candidate biomarker for long-term survival in this disease.
21936894 SLC22A18 downregulation via promoter methylation is associated with the development and progression of glioma.
21144813 Low expression of SLC22A18 was associated with tumor progression, recurrence and poor survival after breast surgery
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18996451 Mutational analysis of the two Sp1 sites suggested their requirement for the promoter activityof SLC22A18.
18996451 recent demonstration that the promoter of this gene is positively regulated by Sp1
16624517 study reports the imprinting status of SLC22A18AS in breast tissue and breast cancer, and shows that gain of imprinting affects both the sense, and antisense transcripts at this locus
16314844 UbcH6-RING105 may define a novel ubiquitin-proteasome pathway that targets TSSC5 in mammalian cells
11925925 involved in the drug resistance mechanism of tumors
9751628 SLC22A18 gene is imprinted, with preferential expression from the maternal allele.

AA Sequence

MQGARAPRDQGRSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIAFGYLQTTFGV      1 - 70
LQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVI     71 - 140
TDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFTCIPASTKGAK    141 - 210
TDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLM    211 - 280
SFFGLLQMVTQGLVIGQLSSHFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD    281 - 350
SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK    351 - 420
DKVR                                                                      421 - 424
//

Text Mined References (27)

PMID Year Title
26196590 2015 Characterization of SLC22A18 as a tumor suppressor and novel biomarker in colorectal cancer.
25498886 2015 microRNA-137 functions as a tumor suppressor in human non-small cell lung cancer by targeting SLC22A18.
24481489 2014 In vitro and in vivo radiosensitization of human glioma U251 cells induced by upregulated expression of SLC22A18.
23514245 2013 Predictive value of the SLC22A18 protein expression in glioblastoma patients receiving temozolomide therapy.
22237119 2012 [Expression and its clinical significance of SLC22A18 in non-small cell lung cancer].
22153794 2012 Correlation of low SLC22A18 expression with poor prognosis in patients with glioma.
21936894 2011 Promoter methylation and downregulation of SLC22A18 are associated with the development and progression of human glioma.
21144813 2011 Low expression of SLC22A18 predicts poor survival outcome in patients with breast cancer after surgery.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
19946888 2010 Defining the membrane proteome of NK cells.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
18996451 2009 Characterization of the human SLC22A18 gene promoter and its regulation by the transcription factor Sp1.
16624517 2006 Gain of imprinting of SLC22A18 sense and antisense transcripts in human breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314844 2006 Tumor suppressor candidate TSSC5 is regulated by UbcH6 and a novel ubiquitin ligase RING105.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11925925 2001 [Mechanisms of drug resistance and reversal of the resistance].
11076855 2000 Sequence and comparative analysis of the mouse 1-megabase region orthologous to the human 11p15 imprinted domain.
9802569 1998 A novel gene, ITM, located between p57KIP2 and IPL, is imprinted in mice.
9751628 1998 Somatic mutation of TSSC5, a novel imprinted gene from human chromosome 11p15.5.
9744804 1998 Functional characterization of ORCTL2--an organic cation transporter expressed in the renal proximal tubules.
9570947 1998 Divergently transcribed overlapping genes expressed in liver and kidney and located in the 11p15.5 imprinted domain.
9520460 1998 Transcriptional map of 170-kb region at chromosome 11p15.5: identification and mutational analysis of the BWR1A gene reveals the presence of mutations in tumor samples.
9499412 1998 IMPT1, an imprinted gene similar to polyspecific transporter and multi-drug resistance genes.