Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.52
PubTator Score 21.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.500 7.9e-03
uncontrolled asthma 1.100 1.9e-02
osteosarcoma -4.797 2.3e-08
tuberculosis 1.200 4.6e-04
group 3 medulloblastoma 1.700 2.1e-03
pancreatic carcinoma 1.500 7.9e-03
nasopharyngeal carcinoma -1.800 1.8e-08

Gene RIF (16)

PMID Text
26499074 findings may greatly contribute to the elucidation of the roles of the Oct and Myc proteins in osteoblast direct reprogramming. The results may also lead to establishment of novel regenerative therapy for various bone resorption diseases
26314988 Deletions in SLC22A16, a doxorubicin transporter, are associated with a failure to achieve event free survival in immunochemotherapy-treated diffuse large B-cell lymphoma.
25998464 Knockdown of CT2 reduced the growth and viability of acute myeloid leukemia cells with high expression of CT2 (OCI-AML2 and HL60), but not low expression. CT2 knockdown reduced basal oxygen consumption without a concomitant increase in glycolysis.
25772757 Both gene and protein expression of OCT6 were decreased in both CDDP-resistant lung cancer cell lines compared with their expression in their respective parental cells.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20179710 Variant alleles in the ABCB1, SLC22A16 and CYP2B6 genes are associated with response to AC therapy in the treatment of breast cancer.
20179710 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20037140 that hCT2 can mediate bleomycin-A5 and polyamine uptake, and that the rate of bleomycin-A5 accumulation may account for the differential response to the drug in patients.
17581421 SLC22A16 was abundantly expressed in clear-cell adenocarcinomaof the ovary.
17559346 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17559346 Exploratory study suggests that the c.146A>G variation could contribute to variations in the pharmacokinetics of doxorubicin and doxorubicinol in Asian breast cancer patients.
17197897 may be possible to use progestins to increase the response of endometrioid endometrial carcinoma with SLC22A16 expression to adriamycin-based chemotherapeutic regimens
15963465 cytotoxic assays, stable transfectants of leukemic Jurkat cells overexpressing SLC22A16 cells became significantly more sensitive to doxorubicin
12384147 Identification as a novel organic cation transporter preferentially expressed in hematopoietic cells and leukemias
12372408 Flipts might have a role in carnitine transport, particularly in brain
12089149 identification, expression and function of human CT2 as a carnitine transporter in testis mediating transport of l-carnitine

AA Sequence

MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWS      1 - 70
LEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTA     71 - 140
VTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMA    141 - 210
ARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVP    211 - 280
FILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLF    281 - 350
YNWSITKRTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAY    351 - 420
SLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASI    421 - 490
LAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAKLESENESKSSKLLLTTNNS    491 - 560
GLEKTEAITPRDSGLGE                                                         561 - 577
//

Text Mined References (19)

PMID Year Title
26499074 2015 Transduction of Oct6 or Oct9 gene concomitant with Myc family gene induced osteoblast-like phenotypic conversion in normal human fibroblasts.
26314988 2015 Whole-exome analysis reveals novel somatic genomic alterations associated with outcome in immunochemotherapy-treated diffuse large B-cell lymphoma.
25998464 2015 Carnitine transporter CT2 (SLC22A16) is over-expressed in acute myeloid leukemia (AML) and target knockdown reduces growth and viability of AML cells.
25772757 2015 Organic cation transporter OCT6 mediates cisplatin uptake and resistance to cisplatin in lung cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20179710 2010 Influence of pharmacogenetics on response and toxicity in breast cancer patients treated with doxorubicin and cyclophosphamide.
20037140 2010 The human carnitine transporter SLC22A16 mediates high affinity uptake of the anticancer polyamine analogue bleomycin-A5.
17581421 2007 Expression of organic cation transporter SLC22A16 in human epithelial ovarian cancer: a possible role of the adriamycin importer.
17559346 2007 Novel SLC22A16 polymorphisms and influence on doxorubicin pharmacokinetics in Asian breast cancer patients.
17473959 2007 Polyspecific organic cation transporters: structure, function, physiological roles, and biopharmaceutical implications.
17197897 2007 Expression of organic cation transporter SLC22A16 in human endometria.
15963465 2005 Characterization of the organic cation transporter SLC22A16: a doxorubicin importer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384147 2002 Identification of OCT6 as a novel organic cation transporter preferentially expressed in hematopoietic cells and leukemias.
12372408 2002 Novel human cDNAs homologous to Drosophila Orct and mammalian carnitine transporters.
12089149 2002 Molecular identification of a novel carnitine transporter specific to human testis. Insights into the mechanism of carnitine recognition.