Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.69
PubTator Score 1.81

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 4.3e-05
Disease Target Count Z-score Confidence
Nephronophthisis 74 4.058 2.0


  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.437 4.3e-05

Gene RIF (2)

20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

ETRDQPLSESLNHSSQIRNKVKDMKTKETSSDDV                                        561 - 594

Text Mined References (10)

PMID Year Title
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231028 1999 Characterization of a 1200-kb genomic segment of chromosome 3p22-p21.3.
10213508 1999 Molecular cloning of a candidate tumor suppressor gene, DLC1, from chromosome 3p21.3.
10072596 1998 Molecular cloning, mapping, and characterization of two novel human genes, ORCTL3 and ORCTL4, bearing homology to organic-cation transporters.