Property Summary

NCBI Gene PubMed Count 42
PubMed Score 48.90
PubTator Score 58.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.231 2.4e-02
medulloblastoma, large-cell 1.100 1.6e-04
ovarian cancer 1.200 1.2e-06

Gene RIF (24)

PMID Text
26740304 The regulation of hOAT4 activity was mediated by sgk2 acting through Nedd4-2.
26303760 modifies placental passage of perfluorinated alkyl acids, may decrease fetal exposure
25919187 SLC22A11 at the basal plasma membrane of human placental syncytiotrophoblasts plays a predominant role in the uptake of 16alpha-OH DHEAS for placental estriol synthesis.
24360580 Our analysis provides evidence for multiple ancestral-specific effects across the SLC22A11/SLC22A12 locus that presumably influence the activity of OAT4 and URAT1 and risk of gout.
24025986 A common variant of OAT4/SLC22A11 is associated with renal underexcretion type gout in Japanese men.
22753387 When investigating the genes separately, SLC22A11 and SLC2A9 showed a significant interaction, consistent with the former encoding an organic anion/dicarboxylate exchanger, which mediates diuretic transport in the kidney.
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20668102 Genetic variants of human organic anion transporter 4 demonstrate altered transport of endogenous substrates.
20668102 Observational study of genotype prevalence. (HuGE Navigator)
20140636 The down-regulation of hOAT4 activity by activation of protein kinase C and the up-regulation of hOAT4 activity by NHERF-1 are mediated through alteration of hOAT4 internalization.
20015291 Several naturally occurring SNPs encode variant hOAT4s that may impair the renal tubular re-absorption of important drug substrates.
19934028 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19861489 Observational study of gene-disease association. (HuGE Navigator)
19503597 Meta-analysis of gene-disease association. (HuGE Navigator)
19400747 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18985008 Findings suggest that hOAT4 and caveolin-1 share a cellular expression in the plasma membrane and caveolin-1 up-regulates the organic anionic compound uptake by hOAT4 under the normal physiological condition.
18414001 The present study demonstrates that hOAT4 variants can causing inter-individual variation in anionic drug uptake and, therefore, could be used as markers for certain diseases including osteoporosis.
18414001 Observational study of gene-disease association. (HuGE Navigator)
17602283 The interaction of PDZ proteins with hOAT4 may be cell-specific. In placenta, a different set of interacting proteins from PDZK1 and NHERF1 may be required to modulate hOAT4 activity.
17229912 hOAT4 is the long-postulated, low-affinity apical urate anion exchanger that facilitates hydrochlorothiazide-associated hyperuricemia.
15576633 Glycosylation serves as a means to specifically regulate hOAT4 function in vivo.
11855680 elucidation of the molecular mechanism for renal tetracycline transport by human organic anion transporters (hOATs) using proximal tubular cells stably expressing hOATs

AA Sequence

MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAVSTNMTPKALL      1 - 70
TISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG     71 - 140
LKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQLAVAGTSTIFAPTFVIYCGLRFVAAFGMAGI    141 - 210
FLSSLTLMVEWTTTSRRAVTMTVVGCAFSAGQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESA    211 - 280
RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAML    281 - 350
VVNFSLLISYYGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM    351 - 420
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGPLILMSRQALP    421 - 490
LLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQEAVTVESTSL              491 - 550
//

Text Mined References (42)

PMID Year Title
26740304 2016 Serum- and glucocorticoid-inducible kinase SGK2 regulates human organic anion transporters 4 via ubiquitin ligase Nedd4-2.
26303760 2015 Organic anion transporter 4 (OAT 4) modifies placental transfer of perfluorinated alkyl acids PFOS and PFOA in human placental ex vivo perfusion system.
25919187 2015 Role of OAT4 in Uptake of Estriol Precursor 16?-Hydroxydehydroepiandrosterone Sulfate Into Human Placental Syncytiotrophoblasts From Fetus.
24360580 2013 Association analysis of the SLC22A11 (organic anion transporter 4) and SLC22A12 (urate transporter 1) urate transporter locus with gout in New Zealand case-control sample sets reveals multiple ancestral-specific effects.
24025986 2014 A common variant of organic anion transporter 4 (OAT4/SLC22A11) gene is associated with renal underexcretion type gout.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22753387 2013 A urate gene-by-diuretic interaction and gout risk in participants with hypertension: results from the ARIC study.
20884846 2010 Multiple genetic loci influence serum urate levels and their relationship with gout and cardiovascular disease risk factors.
20668102 2010 Genetic variants of human organic anion transporter 4 demonstrate altered transport of endogenous substrates.
20140636 2010 Regulation of human organic anion transporter 4 by protein kinase C and NHERF-1: altering the endocytosis of the transporter.
20015291 2010 Functional characterization of nonsynonymous single nucleotide polymorphisms in the human organic anion transporter 4 (hOAT4).
19934028 2010 Gender is an important determinant of the disposition of the loop diuretic torasemide.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
19861489 2010 Replication of the five novel loci for uric acid concentrations and potential mediating mechanisms.
19503597 2009 Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations.
19400747 2009 Predictors of kidney tubular dysfunction in HIV-infected patients treated with tenofovir: a pharmacogenetic study.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18985008 2008 Co-localization and interaction of human organic anion transporter 4 with caveolin-1 in primary cultured human placental trophoblasts.
18501590 2008 Functional differences in steroid sulfate uptake of organic anion transporter 4 (OAT4) and organic anion transporting polypeptide 2B1 (OATP2B1) in human placenta.
18414001 2008 Identification and characterization of single nucleotide polymorphisms of SLC22A11 (hOAT4) in Korean women osteoporosis patients.
17602283 2008 Comparison of the interaction of human organic anion transporter hOAT4 with PDZ proteins between kidney cells and placental cells.
17229912 2007 Human renal organic anion transporter 4 operates as an asymmetric urate transporter.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16236806 2005 Modulation of renal apical organic anion transporter 4 function by two PDZ domain-containing proteins.
15576633 2005 The role of N-linked glycosylation in protein folding, membrane targeting, and substrate binding of human organic anion transporter hOAT4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15291761 2004 Mutational analysis of histidine residues in human organic anion transporter 4 (hOAT4).
15102942 2004 The role of glycine residues in the function of human organic anion transporter 4.
15037815 2004 Human organic anion transporter 4 is a renal apical organic anion/dicarboxylate exchanger in the proximal tubules.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12024214 2002 Molecular identification of a renal urate anion exchanger that regulates blood urate levels.
12023506 2002 Interaction of human organic anion transporters 2 and 4 with organic anion transport inhibitors.
11909604 2002 Interaction of human organic anion transporters with various cephalosporin antibiotics.
11907186 2002 Human organic anion transporters and human organic cation transporters mediate renal transport of prostaglandins.
11855680 2002 Human organic anion transporters mediate the transport of tetracycline.
11327718 2001 Isolation of a family of organic anion transporters from human liver and kidney.
10660625 2000 Molecular cloning and characterization of multispecific organic anion transporter 4 expressed in the placenta.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.