Property Summary

NCBI Gene PubMed Count 115
PubMed Score 138.00
PubTator Score 484.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.948 7.1e-03

Gene RIF (107)

PMID Text
26872727 This study indicates a promising role for intratumoral OCT1 mRNA expression as a prognostic biomarker in therapeutic algorithms in HCC
26657401 Data show that bisindolylmaleimides (BIMs) Ro 31-8220 also blocks activity of the solute carrier organic cation transporter 1 (OCT1), involved in uptake of marketed drugs in the liver, in a protein kinase C (PKC)-independent manner.
26546461 Data indicate no association was found between genotypes of drug transporters ABCB1, ABCG2, OCT1 genetic polymorphisms and the occurrence of thrombocytopenia.
26354214 A positive association was observed between the expression of the ABCB1 and ABCG2 transporter genes (r=0.407, P<0.05) while no association was observed between the expression of either of the ABC transporter genes with the OCT1 gene
25883089 Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation.
25753371 Homozygous carriers of the polymorphic OCT1 C-allele had no metformin-related toxicity as compared with 41.9% for any metformin-related toxicity in carriers of at least one wild-type A-allele
25582574 hOCT1 is a suitable bendamustine transporter, thereby contributing to its cytotoxic effect depending upon the hOCT1 genetic variants expressed
25358338 The hOCT1 expression level can be an important predictor in CML patients treated with IM.
25155932 Our data suggest that besides bodyweight, OCT1 and ABCC3 genotypes play a significant role in the pharmacokinetics of intravenous morphine and its metabolites in children
24780098 Nucleoside transporters and human OCT1 determine the cellular handling of DNA-methyltransferase inhibitors
24688079 OCT1 plays a significant role in hepatic elimination of serotonin at the transporter level.
24533710 OCT variants ( OCT1, OCT2 and ATM) were significantly associated with elevated baseline and glucose-induced C-peptide levels in polycystic ovary syndrome
24530383 Clopidogrel/clopidogrel carboxylate are strong inhibitors and high affinity substrates of OCT1.
24524306 Data show that organic cation transporter (hOCT1) exon 2 GG homozygotes had higher imatinib (IM) levels than CG/CC genotypes, but the difference was not statistically significant.
24469953 Decreased SLC22A1 mRNA expression is associated with low imatinib response in chronic myeloid leukemia.
24399729 Glucocorticoid receptor-induced expression of HNF4alpha may contribute to indirect OCT1 gene up-regulation by dexamethasone in primary human hepatocytes.
24352644 Cellular uptake of imatinib is independent of OCT1, and therefore OCT1 is apparently not a valid biomarker for imatinib resistance.
24215657 OCT1 genetic variants are associated with long term outcomes in imatinib treated chronic myeloid leukemia patients.
24117365 The SNP 408V>M (g.1222G>A) was present in 65% of CML patients & was associated in all cases with an 8-base-pair insertion (8(+) allele) at the 3' end of exon 7. Patients lacking 8(+) and 3(-) showed the best outcomes.
23929842 The expression of Oct1 mRNA is mediated by loss of T cells, but not B cells in immune-mediated liver disease.
23922447 The intron 1 evolutionary conserved region of OCT1 increases Oct1 promoter activity.
23859569 OCT1 genotypes play a significant role in intravenous morphine pharmacokinetics
23836662 demonstrated that PER2 served as a transcriptional corepressor, which recruited polycomb proteins EZH2 and SUZ12 as well as HDAC2 to octamer transcription factor 1 (OCT1) (POU2F1) binding sites of the TWIST1 and SLUG promoters
23612856 The present study is the first report on the association of OCT-1 genetic polymorphisms with the overall development and jaundice-type progression of primary biliary cirrhosis.
23545524 hOCT1 in the sinusoidal membrane of hepatocytes, and potentially the basolateral membrane of proximal tubule cells, is likely to play a role in the disposition of fluoroquinolone antimicrobial agents.
23532667 Hepatocellular carcinoma and cholangiocarcinoma is accompanied by OCT1(SCC22A1) down-regulation together with the appearance of genetic variants that may affect the ability of these tumors to take up and respond to sorafenib (chemoresistance).
23440379 The downregulation of OCT1 is associated with tumor progression and worse overall patient survival rates.
23333304 HIV-1 Vif upregulates the expression of solute carrier family 22, member 1 (SLC22A1) in Vif-expression T cells
23272163 SLC22A1-ABCB1 haplotypes may influence IM pharmacokinetics in Asian CML patients.
23223357 The hOCT1 SNPs M420del and M408V alter imatinib uptake and M420del modifies clinical outcome in imatinib-treated chronic myeloid leukemia.
23144633 the data indicate that Oct1 regulates normal and cancer stem cell function
22913740 Rhodamine 123 is a high-affinity substrate for both hOCT1 and hOCT2.
22875535 The accumulation of lamivudine in CD4 cells of HIV-infected patients is related to the expression of OCT1 and OCT2.
22810231 A substrate binding hinge domain is critical for transport-related structural changes of organic cation transporter 1.
22735389 Seven polymorphisms in OCT1, OCT2, and MATE1 genes were compared between 53 type 2 diabetes patients with side effects of metformin and 193 metformin users without symptoms of metformin intolerance.
22718759 data suggest a model for the sequence of binding events involved in synergistic gene regulation by Sox2 and Oct1
22508387 evaluated the pretherapeutic mRNA expression of the hOCT1 (human organic cation transporter 1) gene in patients with chronic-phase (CP) chronic myeloid leukemia (CML) who varied in terms of their response to imatinib
22498645 Expression levels of OCT1 were not changed in relation to the -1756 genotypes.
22483271 This mini-review discusses structural requirements for both OCT1 and OCT2 versus the blood-brain barrier choline transporter (BBBCHT) are discussed and compared.
22207690 High-dose imatinib leads to superior molecular responses in patients with low OCT-1 activity.
22202118 OCT1-positive cell lines and transfectants exhibit significantly higher susceptibilities to the cytotoxic effects of irinotecan and paclitaxel compared with those of OCT1-negative controls.
21104302 Oct1 plays an important role in the pharmacokinetics, tissue distribution and toxicity of hepatotoxic compounds.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20960210 the -13915*G SNP region (associated with lactase persistence) of the lactase gene interacts with the Oct-1 transcription factor in in vitro binding reactions.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20921968 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20720558 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20680652 associated the rs622342 A > C polymorphism with higher prescribed doses of all anti-Parkinsonian drugs
20680652 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20660041 Genetic variation in OCT1 may be associated with heterogeneity in the metabolic response to metformin in women with PCOS.
20445576 hOCT1 transcript levels and single nucleotide polymorphisms are associated with response to imatinib in chronic myeloid leukemia.
20445576 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20429798 There was no clear association between the SLC22A1, SLC22A2, and SLC22A3 genes and diabetic nephropathy or hypertension
20429798 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20371711 The influence of organic cation transporters 1, 2, and 3 (OCT1, OCT2, and OCT3) and their genetic variants on cellular uptake of picoplatin and on the individual components of the ensuing cytotoxicity such as DNA adduct formation, was determined.
20363215 Gefitinib may exert an inhibitory effect on the intracellular accumulation of drugs transported by hOCT1 and hOCT2.
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20143233 Results reveal the presence of different protein complexes, including GATA-1 and Oct-1, involved in Gfi1b regulation.
19954617 There is no correlation between the polymorphisms of hOCT1-P283L, R287G, M408V and secondary imatinib resistance in CML patients, but the polymorphisms of hOCT1-283T, 287G may be good predictors for IM response.
19954617 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19950608 hOCT1 has no association with the stage and course of chronic myelogeneous leukemia, nor with the effectiveness of imatinib mesylate therapy.
19898263 interaction between polymorphisms and MATE1 transporter polymorphisms on the glucose lowering effect of metformin
19833842 YM155 is a substrate for OCT1 and OCT2, whereas it is unlikely for OCT3.
19591196 Cholestasis and genetic variants are critical determinants for considerable interindividual variability of hepatic OCT1 and OCT3 expression in human liver.
19591196 Observational study of gene-disease association. (HuGE Navigator)
19584153 Data show that the GG genotype in ABCG2, AA genotype in CYP3A5 were associated with poor response to IM, whereas the GG genotype at SLC22A1 was correlated with high rate of loss of response or treatment failure to IM therapy.
19584153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19536068 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19381165 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336679 The SLC22A1 loss-of-function variant does not attenuate the hemoglobin A1c reduction achieved by metformin in type 2 diabetics.
19336679 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19021069 Heterozygote R61C genotype (C/T) was demonstrated in five of 32 CML patients treated with imatinib; there is no evidence that response to imatinib treatment is impaired in R61C heterozygote individuals
18669873 hOCT1 is not required for dasatinib uptake in human cells
18559609 Unlike imatinib, dasatinib cellular uptake is not significantly affected by OCT-1 activity, so that expression and function of OCT-1 is unlikely to affect response to dasatinib.
18483382 SLC22A1 expression is a composite surrogate for expression of various transporters relevant to imatinib intracellular uptake and retention
17971819 Varenicline was characterized as a moderate-affinity substrate for hOCT2 (K(m)=370 microM) and its hOCT2-mediated uptake was partially inhibited by cimetidine.
17934801 P-gp, rather than BCRP or OCT1, is partially responsible for the development of imatinib-resistance due to constitutive and functional overexpression, leading to reduced intracellular accumulation of imatinib in resistant K562 cells.
17701831 These results suggest that the saturable component in the hepatic uptake of these cationic compounds may be mediated mainly by hOCT1/rOct1.
17635184 Cholesterol treatment led to increased levels of NTCP and OCT-1 mRNAs.
17609683 OCT1 genotype is a determinant of metformin pharmacokinetics.
17568400 Expression of hOCT1 is important in determining the clinical response to imatinib.
17476361 Genetic variation in OCT1 may be associated with variation in response to metformin.
17393420 The organic cation transporter 2 (OCT2) mRNA expression was exclusively detected in few scattered stromal cells and OCT1 mRNA was not detected at all.
17220237 Observational study of genotype prevalence. (HuGE Navigator)
17220237 findings suggest that genetic variants of hOCTs are not linked among three genes in a Korean population, and several of the hOCT genetic variants cause decreased transport activity in vitro compared with the wild type
17111267 Observational study of gene-disease association. (HuGE Navigator)
16597591 interpatient variability in IC50(imatinib) is mainly due to differences in the efficiency of imatinib intracellular uptake and retention, mediated by OCT1
16141367 Ranitidine and famotidine elicited differential inhibitory activities on SLC22A1.
15817714 OCT1 and OCT2 mediate luminal ACh release in human airways
15499200 Observational study of genotype prevalence. (HuGE Navigator)
15499200 Twenty genetic variations, including seven novel ones, have been found in the human SLC22A1 gene from 116 Japanese individuals.
15389554 hOCT1 was inhibited by PKA and endogenously activated by calmodulin, calmodulin-dependent kinase II, and p56(lck) tyrosine kinase
15135235 organic cation transporter EMT mRNA was mainly detected in the intra lobular septa and together with organic cation transporters OCT1 and OCT2 mRNAs also expressed in scattered cells of placental vessel adventitias
14697261 identification of single nucleotide polymorphisms of organic cation transporter 1 (SLC22A1) affecting transport functions
12719534 Evolutionary conserved amino acids predict the function of variants of this protein.
12439218 identification of genetic variations and their functional consequences
12439217 investigation of polymorphisms affecting function
9078256 HIV-1 Vif upregulates the expression of solute carrier family 22, member 1 (SLC22A1) in Vif-expression T cells
8902060 HIV-1 Vif upregulates the expression of solute carrier family 22, member 1 (SLC22A1) in Vif-expression T cells
7690421 HIV-1 Vif upregulates the expression of solute carrier family 22, member 1 (SLC22A1) in Vif-expression T cells
1727476 HIV-1 Vif upregulates the expression of solute carrier family 22, member 1 (SLC22A1) in Vif-expression T cells

AA Sequence

MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEEL      1 - 70
NYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNL     71 - 140
VCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQG    141 - 210
LVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYW    211 - 280
CVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL    281 - 350
MYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM    351 - 420
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREV    421 - 490
WQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT          491 - 554
//

Text Mined References (125)

PMID Year Title
26872727 2016 Organic Cation Transporter 1 (OCT1) mRNA expression in hepatocellular carcinoma as a biomarker for sorafenib treatment.
26657401 2015 Protein Kinase C-Independent Inhibition of Organic Cation Transporter 1 Activity by the Bisindolylmaleimide Ro 31-8220.
26546461 2015 A study to explore the correlation of ABCB1, ABCG2, OCT1 genetic polymorphisms and trough level concentration with imatinib mesylate-induced thrombocytopenia in chronic myeloid leukemia patients.
26354214 2015 Molecular response to imatinib & its correlation with mRNA expression levels of imatinib influx & efflux transporters in patients with chronic myeloid leukaemia in chronic phase.
25883089 2015 Functional characterization of the organic cation transporters (OCTs) in human airway pulmonary epithelial cells.
25753371 2015 Multidrug and toxin extrusion 1 and human organic cation transporter 1 polymorphisms in patients with castration-resistant prostate cancer receiving metformin (SAKK 08/09).
25582574 2015 Human organic cation transporter 1 (hOCT1) as a mediator of bendamustine uptake and cytotoxicity in chronic lymphocytic leukemia (CLL) cells.
25358338 2015 Human organic cation transporter 1 protein levels of granulocytes can optimize imatinib therapy in patients with chronic myeloid leukemia.
25155932 2014 ABCC3 and OCT1 genotypes influence pharmacokinetics of morphine in children.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24780098 2014 Nucleoside transporters and human organic cation transporter 1 determine the cellular handling of DNA-methyltransferase inhibitors.
24688079 2014 Common drugs inhibit human organic cation transporter 1 (OCT1)-mediated neurotransmitter uptake.
24533710 2014 Metformin resistance alleles in polycystic ovary syndrome: pattern and association with glucose metabolism.
24530383 2014 In vitro interaction of clopidogrel and its hydrolysate with OCT1, OCT2 and OAT1.
24524306 2014 Polymorphisms in the human organic cation transporter and the multidrug resistance gene: correlation with imatinib levels and clinical course in patients with chronic myeloid leukemia.
24469953 2014 Reduced ABCG2 and increased SLC22A1 mRNA expression are associated with imatinib response in chronic myeloid leukemia.
24399729 2013 Glucocorticoid receptor regulates organic cation transporter 1 (OCT1, SLC22A1) expression via HNF4? upregulation in primary human hepatocytes.
24352644 2014 Cellular uptake of imatinib into leukemic cells is independent of human organic cation transporter 1 (OCT1).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24215657 2014 OCT1 genetic variants are associated with long term outcomes in imatinib treated chronic myeloid leukemia patients.
24117365 2013 A common novel splice variant of SLC22A1 (OCT1) is associated with impaired responses to imatinib in patients with chronic myeloid leukaemia.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23929842 2013 Differential regulation of hepatic organic cation transporter 1, organic anion-transporting polypeptide 1a4, bile-salt export pump, and multidrug resistance-associated protein 2 transporter expression in lymphocyte-deficient mice associates with interleukin-6 production.
23922447 2013 Hepatocyte nuclear factor 1 regulates the expression of the organic cation transporter 1 via binding to an evolutionary conserved region in intron 1 of the OCT1 gene.
23859569 2013 OCT1 genetic variants influence the pharmacokinetics of morphine in children.
23836662 2013 Loss of corepressor PER2 under hypoxia up-regulates OCT1-mediated EMT gene expression and enhances tumor malignancy.
23612856 2014 Genetic polymorphisms of OCT-1 confer susceptibility to severe progression of primary biliary cirrhosis in Japanese patients.
23545524 2013 Human organic cation transporters 1 (SLC22A1), 2 (SLC22A2), and 3 (SLC22A3) as disposition pathways for fluoroquinolone antimicrobials.
23532667 2013 Expression of SLC22A1 variants may affect the response of hepatocellular carcinoma and cholangiocarcinoma to sorafenib.
23440379 2013 Downregulation of organic cation transporter 1 (SLC22A1) is associated with tumor progression and reduced patient survival in human cholangiocellular carcinoma.
23272163 2012 SLC22A1-ABCB1 haplotype profiles predict imatinib pharmacokinetics in Asian patients with chronic myeloid leukemia.
23223357 2013 The hOCT1 SNPs M420del and M408V alter imatinib uptake and M420del modifies clinical outcome in imatinib-treated chronic myeloid leukemia.
23144633 2012 Transcription factor Oct1 is a somatic and cancer stem cell determinant.
22913740 2014 The mitochondrial fluorescent dye rhodamine 123 is a high-affinity substrate for organic cation transporters (OCTs) 1 and 2.
22875535 2013 Organic cation transporters OCT1 and OCT2 determine the accumulation of lamivudine in CD4 cells of HIV-infected patients.
22810231 2012 A substrate binding hinge domain is critical for transport-related structural changes of organic cation transporter 1.
22735389 2012 Association of genetic variation in the organic cation transporters OCT1, OCT2 and multidrug and toxin extrusion 1 transporter protein genes with the gastrointestinal side effects and lower BMI in metformin-treated type 2 diabetes patients.
22718759 2012 Impact of protein/protein interactions on global intermolecular translocation rates of the transcription factors Sox2 and Oct1 between DNA cognate sites analyzed by z-exchange NMR spectroscopy.
22508387 2012 Pretherapeutic expression of the hOCT1 gene predicts a complete molecular response to imatinib mesylate in chronic-phase chronic myeloid leukemia.
22498645 2012 Inter-individual variability in OCT1 expression and its relationship with OCT1 genotype in liver samples from a Korean population.
22483271 2012 The blood-brain barrier choline transporter.
22207690 2012 Chronic phase chronic myeloid leukemia patients with low OCT-1 activity randomized to high-dose imatinib achieve better responses and have lower failure rates than those randomized to standard-dose imatinib.
22202118 2012 Human organic cation transporter 1 is expressed in lymphoma cells and increases susceptibility to irinotecan and paclitaxel.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21743057 2011 Genome-wide association study identifies new prostate cancer susceptibility loci.
21104302 2011 Role of organic cation transporter 1, OCT1 in the pharmacokinetics and toxicity of cis-diammine(pyridine)chloroplatinum(II) and oxaliplatin in mice.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20960210 2011 13915*G DNA polymorphism associated with lactase persistence in Africa interacts with Oct-1.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20921968 2012 Effects of OCT1 polymorphisms on the cellular uptake, plasma concentrations and efficacy of the 5-HT(3) antagonists tropisetron and ondansetron.
20720558 2010 Influence of CYP3A5 and drug transporter polymorphisms on imatinib trough concentration and clinical response among patients with chronic phase chronic myeloid leukemia.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20680652 2011 OCT1 polymorphism is associated with response and survival time in anti-Parkinsonian drug users.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20660041 2010 Organic cation transporter 1 polymorphisms predict the metabolic response to metformin in women with the polycystic ovary syndrome.
20445576 2010 hOCT1 transcript levels and single nucleotide polymorphisms as predictive factors for response to imatinib in chronic myeloid leukemia.
20429798 2010 Association of the SLC22A1, SLC22A2, and SLC22A3 genes encoding organic cation transporters with diabetic nephropathy and hypertension.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20371711 2010 Organic cation transporters modulate the uptake and cytotoxicity of picoplatin, a third-generation platinum analogue.
20363215 2010 Functional characterization of gefitinib uptake in non-small cell lung cancer cell lines.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20143233 2010 Human promoter mutations unveil Oct-1 and GATA-1 opposite action on Gfi1b regulation.
19954617 2009 [Influence of hOCT1 polymorphism on imatinib mesylate effectiveness in chronic myelogenous leukemia patients].
19950608 2009 [Expression of hOCT1 in patients with chronic myelogeneous leukemia treated by imatinib mesylate].
19898263 2010 Interaction between polymorphisms in the OCT1 and MATE1 transporter and metformin response.
19833842 2010 Characterization of human organic cation transporter 1 (OCT1/SLC22A1)- and OCT2 (SLC22A2)-mediated transport of 1-(2-methoxyethyl)-2-methyl-4,9-dioxo-3-(pyrazin-2-ylmethyl)- 4,9-dihydro-1H-naphtho[2,3-d]imidazolium bromide (YM155 monobromide), a novel small molecule survivin suppressant.
19591196 2009 Expression of organic cation transporters OCT1 (SLC22A1) and OCT3 (SLC22A3) is affected by genetic factors and cholestasis in human liver.
19584153 2009 Clinical relevance of a pharmacogenetic approach using multiple candidate genes to predict response and resistance to imatinib therapy in chronic myeloid leukemia.
19536068 2009 The effects of genetic polymorphisms in the organic cation transporters OCT1, OCT2, and OCT3 on the renal clearance of metformin.
19381165 2009 Genetic variation in the organic cation transporter 1 is associated with metformin response in patients with diabetes mellitus.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336679 2009 Reduced-function SLC22A1 polymorphisms encoding organic cation transporter 1 and glycemic response to metformin: a GoDARTS study.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19141712 2009 Transport of lamivudine [(-)-beta-L-2',3'-dideoxy-3'-thiacytidine] and high-affinity interaction of nucleoside reverse transcriptase inhibitors with human organic cation transporters 1, 2, and 3.
19021069 2008 OCT1 (SLC22A1) R61C polymorphism and response to imatinib treatment in chronic myeloid leukemia patients.
18669873 2008 Effective dasatinib uptake may occur without human organic cation transporter 1 (hOCT1): implications for the treatment of imatinib-resistant chronic myeloid leukemia.
18559609 2008 Dasatinib cellular uptake and efflux in chronic myeloid leukemia cells: therapeutic implications.
18483382 2008 Interaction of imatinib with human organic ion carriers.
17971819 2008 Effect of human renal cationic transporter inhibition on the pharmacokinetics of varenicline, a new therapy for smoking cessation: an in vitro-in vivo study.
17934801 2008 Constitutive overexpression of P-glycoprotein, rather than breast cancer resistance protein or organic cation transporter 1, contributes to acquisition of imatinib-resistance in K562 cells.
17701831 2007 Functional involvement of organic cation transporter1 (OCT1/Oct1) in the hepatic uptake of organic cations in humans and rats.
17635184 2007 The expression of the solute carriers NTCP and OCT-1 is regulated by cholesterol in HepG2 cells.
17609683 2008 Effect of genetic variation in the organic cation transporter 1, OCT1, on metformin pharmacokinetics.
17568400 2008 Expression of the uptake drug transporter hOCT1 is an important clinical determinant of the response to imatinib in chronic myeloid leukemia.
17476361 2007 Effect of genetic variation in the organic cation transporter 1 (OCT1) on metformin action.
17393420 2007 The organic cation transporters (OCT1, OCT2, EMT) and the plasma membrane monoamine transporter (PMAT) show differential distribution and cyclic expression pattern in human endometrium and early pregnancy decidua.
17220237 2007 Identification and functional characterization of genetic variants of human organic cation transporters in a Korean population.
17111267 2007 Human organic cation transporter (OCT1 and OCT2) gene polymorphisms and therapeutic effects of metformin.
16597591 2006 OCT-1-mediated influx is a key determinant of the intracellular uptake of imatinib but not nilotinib (AMN107): reduced OCT-1 activity is the cause of low in vitro sensitivity to imatinib.
16581093 2006 Differential pharmacological in vitro properties of organic cation transporters and regional distribution in rat brain.
16436500 2006 The human organic cation transporter-1 gene is transactivated by hepatocyte nuclear factor-4alpha.
16272756 2005 Metformin is a superior substrate for renal organic cation transporter OCT2 rather than hepatic OCT1.
16263091 2005 Drug specificity and intestinal membrane localization of human organic cation transporters (OCT).
16141367 2005 Differential substrate and inhibitory activities of ranitidine and famotidine toward human organic cation transporter 1 (hOCT1; SLC22A1), hOCT2 (SLC22A2), and hOCT3 (SLC22A3).
15817714 2005 Polyspecific cation transporters mediate luminal release of acetylcholine from bronchial epithelium.
15499200 2004 Seven novel single nucleotide polymorphisms in the human SLC22A1 gene encoding organic cation transporter 1 (OCT1).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389554 2004 Regulation of the human organic cation transporter hOCT1.
15135235 2004 Norepinephrine transporter (NET), serotonin transporter (SERT), vesicular monoamine transporter (VMAT2) and organic cation transporters (OCT1, 2 and EMT) in human placenta from pre-eclamptic and normotensive pregnancies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697261 2004 Novel single nucleotide polymorphisms of organic cation transporter 1 (SLC22A1) affecting transport functions.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12719534 2003 Evolutionary conservation predicts function of variants of the human organic cation transporter, OCT1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439218 2002 Identification of genetic variations of the human organic cation transporter hOCT1 and their functional consequences.
12439217 2002 Polymorphisms affecting function of the human organic cation transporter hOCT1 (SLC22A1): what are the consequences?
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11543633 2001 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1.
11447227 2001 Properties and regulation of organic cation transport in freshly isolated human proximal tubules.
11408531 2001 Comparison of "type I" and "type II" organic cation transport by organic cation transporters and organic anion-transporting polypeptides.
11388889 1999 Molecular cloning, functional characterization and genomic organization of four alternatively spliced isoforms of the human organic cation transporter 1 (hOCT1/SLC22A1).
11136971 2000 Synergism with the coactivator OBF-1 (OCA-B, BOB-1) is mediated by a specific POU dimer configuration.
10541551 1999 Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
9933568 1999 Cloning of the mouse and human solute carrier 22a3 (Slc22a3/SLC22A3) identifies a conserved cluster of three organic cation transporters on mouse chromosome 17 and human 6q26-q27.
9655880 1998 Functional characterization of an organic cation transporter (hOCT1) in a transiently transfected human cell line (HeLa).
9605850 1997 The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26.
9260930 1997 Cloning and characterization of two human polyspecific organic cation transporters.
9187257 1997 Cloning and functional expression of a human liver organic cation transporter.
9078256 1997 The octamer-binding proteins Oct-1 and Oct-2 repress the HIV long terminal repeat promoter and its transactivation by Tat.
8902060 1996 Functional interaction between the HIV-1 Tat transactivator and the inhibitory domain of the Oct-2 cellular transcription factor.
7690421 1993 In vitro and in vivo binding of human immunodeficiency virus type 1 Tat protein and Sp1 transcription factor.
1727476 1992 Functional roles for the TATA promoter and enhancers in basal and Tat-induced expression of the human immunodeficiency virus type 1 long terminal repeat.