Property Summary

NCBI Gene PubMed Count 42
PubMed Score 197.30
PubTator Score 98.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ulcerative colitis 1819 3.5e-06
glioblastoma 5792 3.3e-05
interstitial cystitis 2312 5.5e-04
psoriasis 6694 1.2e-03
adult high grade glioma 3801 3.1e-03
ependymoma 4679 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 3.1e-03
ependymoma 1.500 2.3e-02
glioblastoma -1.200 3.3e-05
interstitial cystitis -1.100 5.5e-04
psoriasis -1.500 1.2e-03
ulcerative colitis -1.400 3.5e-06

Gene RIF (33)

AA Sequence

MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETI      1 - 70
RKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMEL     71 - 140
VKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVLGLVL    141 - 210
PMWAIALISFGVALLFAFFVWLFVCPWMRRKITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKAN    211 - 280
DDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKD    281 - 350
SGLYKDLLHKIHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT    351 - 420
VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDAPEVHLLFHFL    421 - 490
QVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMG    491 - 560
KDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTV    561 - 630
PVAGLFSAAVMALLMYGILPYV                                                    631 - 652
//

Text Mined References (49)

PMID Year Title