Property Summary

Ligand Count 2
NCBI Gene PubMed Count 12
PubMed Score 48.19
PubTator Score 13.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
group 3 medulloblastoma 4104 8.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 1.1
Disease Target Count Z-score Confidence
Neurofibromatosis 40 3.224 1.6
Hereditary night blindness 3 3.071 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 2.700 8.1e-04

Gene RIF (6)

AA Sequence

MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRMLKMMILPLVV      1 - 70
SSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAAQKETTEQSGKPIMSSADALL     71 - 140
DLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVY    141 - 210
KSEPGTSDGMNVLGIVFFSATMGIMLGRMGDSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKI    211 - 280
LEMDDPRAVGKKLGFYSVTVVCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPI    281 - 350
TFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA    351 - 420
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDFARDTGTEKL    421 - 490
LPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV    491 - 560
//

Text Mined References (15)

PMID Year Title