Property Summary

Ligand Count 19
NCBI Gene PubMed Count 90
PubMed Score 569.66
PubTator Score 247.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Epilepsy 792 4.144 2.1
Autistic Disorder 364 0.0 0.0
Episodic ataxia, type 6 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (25)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 5.2e-06
atypical teratoid / rhabdoid tumor -2.300 4.1e-03
cystic fibrosis 1.153 1.4e-02
Down syndrome 1.100 1.3e-02
ductal carcinoma in situ -1.100 2.1e-02
ependymoma 3.100 1.1e-02
fibroadenoma -2.100 4.0e-02
glioblastoma 1.700 4.4e-04
group 3 medulloblastoma -3.000 3.8e-08
intraductal papillary-mucinous adenoma (... -2.000 7.7e-04
intraductal papillary-mucinous carcinoma... -2.200 6.7e-04
intraductal papillary-mucinous neoplasm ... -1.500 2.9e-02
invasive ductal carcinoma 1.405 4.3e-05
lung cancer -2.300 3.5e-05
lung carcinoma -1.700 2.5e-08
malignant mesothelioma 3.800 1.4e-09
medulloblastoma, large-cell -3.600 1.4e-06
oligodendroglioma 2.200 2.1e-02
ovarian cancer 2.000 1.7e-04
pediatric high grade glioma 1.200 4.7e-03
Pick disease 1.100 8.1e-03
pituitary cancer -1.100 1.2e-03
primitive neuroectodermal tumor -1.800 1.1e-02
Rheumatoid arthritis 1.200 4.9e-02
subependymal giant cell astrocytoma -1.623 4.4e-02

 GWAS Trait (1)

Gene RIF (68)

AA Sequence

MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRP      1 - 70
YRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGII     71 - 140
IVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLV    141 - 210
GAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMR    211 - 280
LVAVIMWYAPVGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIG    281 - 350
GLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE    351 - 420
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLG    421 - 490
AGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM                      491 - 542
//

Text Mined References (94)

PMID Year Title