Property Summary

Ligand Count 23
NCBI Gene PubMed Count 95
PubMed Score 395.60
PubTator Score 234.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (82)

AA Sequence

MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPL      1 - 70
IISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGVTQKVGEIARTGSTPEVSTVD     71 - 140
AMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVGMYSDGI    141 - 210
NVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFR    211 - 280
KLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQV    281 - 350
DKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV    351 - 420
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALEST    421 - 490
ILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF                                        491 - 524
//

Text Mined References (96)

PMID Year Title