Tchem Excitatory amino acid transporter 3

Add to cart

View Collections

Empty Collection

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7914198, PubMed:7521911, PubMed:8857541, PubMed:26690923, PubMed:21123949). Can also transport L-cysteine (PubMed:21123949). Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion (PubMed:7521911, PubMed:8857541, PubMed:26690923). Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport (PubMed:8857541, PubMed:26690923). Plays an important role in L-glutamate and L-aspartate reabsorption in renal tubuli (PubMed:21123949). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (By similarity). Negatively regulated by ARL6IP5 (By similarity).

This gene encodes a member of the high-affinity glutamate transporters that play an essential role in transporting glutamate across plasma membranes. In brain, these transporters are crucial in terminating the postsynaptic action of the neurotransmitter glutamate, and in maintaining extracellular glutamate concentrations below neurotoxic levels. This transporter also transports aspartate, and mutations in this gene are thought to cause dicarboxylicamino aciduria, also known as glutamate-aspartate transport defect. [provided by RefSeq, Mar 2010]

Comments

Property Summary

Ligand Count	19
NCBI Gene PubMed Count	95
PubMed Score	395.60

PubTator Score	234.66

Knowledge Summary

Patent

No data available

TINX Plot

Disease (5)

Disease	Target Count	Z-score	Confidence
Epilepsy	792	4.352	2.2
Schizophrenia	1160	4.091	2.0
Low tension glaucoma	7	3.847	1.9
Atrophy	10	0.0	0.0
Brain Diseases	24	0.0	0.0
Cognition Disorders	32	0.0	0.0
Endometriosis	540	0.0	0.0
Epilepsy, Temporal Lobe	23	0.0	0.0
Malformations of Cortical Development	13	0.0	0.0
Nerve Degeneration	121	0.0	0.0
Retinal Degeneration	106	0.0	0.0
Seizures	596	0.0	0.0

Disease	Target Count
Atrophic	10
Bipolar Disorder	666
Depressive disorder	409
Dicarboxylicaminoaciduria	1
Mental Depression	333

Disease	Target Count	Z-score	Confidence
Carcinoma	11493	0.0	0.5

Disease	Target Count	Z-score	Confidence
obsessive-compulsive disorder	61	5.768	2.9
Amyotrophic lateral sclerosis	451	3.828	1.9
Toxic encephalopathy	141	3.412	1.7
Chronic tic disorder	8	3.166	1.6
Parkinson's disease	392	3.1	1.6
Vascular disease	319	3.018	1.5

Disease	Target Count
Dicarboxylic aminoaciduria	4

Thyroid 18,024

Small Intestine - Terminal Ileum 17,954

Cells - EBV-transformed lymphocytes 18,186

Brain - Frontal Cortex (BA9) 18,069

Liver 18,071

Brain - Hypothalamus 18,169

Cells - Transformed fibroblasts 17,577

Brain - Cortex 18,039

Lung 18,057

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Caudate (basal ganglia) 18,001

Brain - Cerebellar Hemisphere 18,015

Brain - Hippocampus 18,011

Pituitary 18,147

Brain - Substantia nigra 17,981

Brain - Amygdala 18,006

Adipose - Subcutaneous 18,110

Brain - Cerebellum 17,983

Colon - Transverse 17,825

Brain - Putamen (basal ganglia) 17,863

Prostate 18,213

Brain - Spinal cord (cervical c-1) 17,973

Breast - Mammary Tissue 18,103

Kidney - Cortex 17,329

Adipose - Visceral (Omentum) 17,937

Nerve - Tibial 18,007

Colon - Sigmoid 18,089

Uterus 17,618

Artery - Tibial 17,631

Minor Salivary Gland 18,005

Artery - Aorta 17,896

Artery - Coronary 17,949

Vagina 17,834

Esophagus - Muscularis 18,017

Stomach 17,879

Esophagus - Gastroesophageal Junction 18,000

Esophagus - Mucosa 18,076

Skin - Sun Exposed (Lower leg) 17,968

Skin - Not Sun Exposed (Suprapubic) 18,081

Heart - Left Ventricle 18,006

Testis 18,518

Heart - Atrial Appendage 17,896

Muscle - Skeletal 17,778

Pancreas 18,123

Ovary 17,971

Adrenal Gland 18,071

Spleen 17,614

Whole Blood 17,439

Adult Liver 9,113

Adult Retina 10,115

Adult Kidney 6,723

Fetal Brain 7,866

Adult Frontal Cortex 9,048

Fetal Gut 8,640

Brain

Frontal lobe

Gut

Kidney

Liver

Retina

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

Cerebral cortex 159

Placenta 3,079

See source...

Brain 1,516

Neuron 779

Spinal cord 549

BTO:0000964 256

lat1 36

Ganglion 334

C6 glioma cell 8

Retina 330

Caput epididymis 5

See source...

Synonym

Accession	P43005 O75587 Q5VZ24 Q8N199 Q9UEW2
Symbols	DCBXA EAAC1 EAAT3 SCZD18

Gene

SLC1A1

PANTHER Protein Class (2)

transporter 580

cation transporter 127

Ortholog (1)

Species	Source	Disease
Chimp	OMA EggNOG

UniProt Keyword (18)

Complete proteome 20,231

Metal-binding 3,672

Polymorphism 12,194

Reference proteome 20,231

Disease mutation 2,804

Phosphoprotein 8,216

Cell membrane 3,390

Glycoprotein 4,623

Membrane 7,361

Transmembrane 5,228

See all...

GO Function (8)

metal ion binding 2,256

amino acid transmembrane transporter act... 41

L-glutamate transmembrane transporter ac... 11

glutamate binding 11

chloride transmembrane transporter activ... 8

high-affinity glutamate transmembrane tr... 7

glutamate:sodium symporter activity 3

cysteine transmembrane transporter activ... 1

GO Component (5)

membrane 1,917

plasma membrane 4,414

integral component of plasma membrane 1,418

apical plasma membrane 292

extracellular exosome 2,767

GO Process (13)

chemical synaptic transmission 219

protein homooligomerization 206

ion transport 99

chloride transmembrane transport 32

positive regulation of heart rate 18

D-aspartate import 4

L-glutamate import across plasma membran... 5

glutamate secretion 28

L-glutamate import 3

L-glutamate transmembrane transport 4

See all...

Compartment GO Term (24)

Apical part of cell 355

Apical plasma membrane 235

Cell 16,178

Cell part 16,177

Cell periphery 5,381

Cell projection 1,541

Extracellular region 2,731

Glutamatergic synapse 37

Integral component of membrane 5,330

Integral component of plasma membrane 1,693

Intracellular 14,108

Intrinsic component of membrane 5,457

Intrinsic component of plasma membrane 1,749

Membrane 8,530

Membrane part 6,553

See all...

IMPC Phenotype (1)

increased circulating iron level 30

MGI Phenotype (7)

homeostasis-metabolism phenotype 4,747

cellular phenotype 3,637

vision-eye phenotype 1,622

nervous system phenotype 3,447

renal-urinary system phenotype 1,269

behavior-neurological phenotype 3,401

adipose tissue phenotype 992

GWAS Trait (5)

Coronary artery calcification 44

Interleukin-17 levels 22

Pancreatic cancer 30

Parental extreme longevity (95 years and... 56

Smoking quantity 7

HCA RNA Cell Line (55)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (41)

Protein digestion and absorption 90

Glutamatergic synapse 116

http://identifiers.org/panther.pathway/P... 42

http://identifiers.org/panther.pathway/P... 65

http://identifiers.org/smpdb/SMP00078 32

http://identifiers.org/smpdb/SMP00080 32

http://identifiers.org/smpdb/SMP00081 32

http://identifiers.org/smpdb/SMP00088 32

http://identifiers.org/smpdb/SMP00090 32

http://identifiers.org/smpdb/SMP00091 32

See all...

Gene RIF (82)

AA Sequence

MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPL      1 - 70
IISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGVTQKVGEIARTGSTPEVSTVD     71 - 140
AMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVGMYSDGI    141 - 210
NVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFR    211 - 280
KLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQV    281 - 350
DKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV    351 - 420
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALEST    421 - 490
ILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF                                        491 - 524
//

Text Mined References (96)

Summary
Details

	PMID	Year	Title

Tchem Excitatory amino acid transporter 3 Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent

No data available

TINX Plot

Disease (5)

Expression

Synonym

Gene

PANTHER Protein Class (2)

Ortholog (1)

UniProt Keyword (18)

GO Function (8)

GO Component (5)

GO Process (13)

Compartment GO Term (24)

IMPC Phenotype (1)

MGI Phenotype (7)

GWAS Trait (5)

HCA RNA Cell Line (55)

Pathway (41)

Protein-protein Interaction (24)

Drug (1)

Ligand (18)

Gene RIF (82)

AA Sequence

Text Mined References (96)

Tchem Excitatory amino acid transporter 3

Add to cart

View Collections

Empty Collection