Property Summary

NCBI Gene PubMed Count 41
PubMed Score 73.24
PubTator Score 64.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.136 2.0e-02
active ulcerative colitis -1.239 2.7e-02
breast carcinoma -1.700 7.1e-03
colon cancer -2.900 1.8e-06
ductal carcinoma in situ -3.900 2.2e-04
fibroadenoma -2.600 1.4e-02
invasive ductal carcinoma -4.400 6.6e-04
lung adenocarcinoma -1.900 3.3e-11
lung cancer -1.600 5.7e-03
lung carcinoma -3.000 2.2e-20
non-small cell lung cancer -1.369 5.8e-13
ovarian cancer -1.200 2.9e-08

Gene RIF (32)

AA Sequence

MDCYRTSLSSSWIYPTVILCLFGFFSMMRPSEPFLIPYLSGPDKNLTSAEITNEIFPVWTYSYLVLLLPV      1 - 70
FVLTDYVRYKPVIILQGISFIITWLLLLFGQGVKTMQVVEFFYGMVTAAEVAYYAYIYSVVSPEHYQRVS     71 - 140
GYCRSVTLAAYTAGSVLAQLLVSLANMSYFYLNVISLASVSVAFLFSLFLPMPKKSMFFHAKPSREIKKS    141 - 210
SSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFY    211 - 280
WSLWWAFATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGYVKVNWDLLGELALV    281 - 350
VFSVVNAGSLFLMHYTANIWACYAGYLIFKSSYMLLITIAVFQIAVNLNVERYALVFGINTFIALVIQTI    351 - 420
MTVIVVDQRGLNLPVSIQFLVYGSYFAVIAGIFLMRSMYITYSTKSQKDVQSPAPSENPDVSHPEEESNI    421 - 490
IMSTKL                                                                    491 - 496
//

Text Mined References (41)

PMID Year Title