Tchem Folate transporter 1

Add to cart

View Collections

Empty Collection

Transporter for the intake of folate. Uptake of folate in human placental choriocarcinoma cells occurs by a novel mechanism called potocytosis which functionally couples three components, namely the folate receptor, the folate transporter, and a V-type H(+)-pump.

The membrane protein encoded by this gene is a transporter of folate and is involved in the regulation of intracellular concentrations of folate. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

Comments

Property Summary

Ligand Count	17
NCBI Gene PubMed Count	166
PubMed Score	97.75

PubTator Score	217.80

Knowledge Summary

Patent

No data available

TINX Plot

Disease (5)

Disease	Target Count	Z-score	Confidence
Adenocarcinoma of lung	142	0.0	0.0
Adenoma	167	0.0	0.0
Autistic Disorder	364	0.0	0.0
Cleft Lip	141	0.0	0.0
Cleft Palate	271	0.0	0.0
Clinical Deterioration	6	0.0	0.0
Colonic Neoplasms	142	0.0	0.0
Colorectal Neoplasms	243	0.0	0.0
Disease Models, Animal	155	0.0	0.0
Down syndrome	499	0.0	0.0
Drug-Related Side Effects and Adverse Reactions	62	0.0	0.0
Nervous System Diseases	53	0.0	0.0
Precursor Cell Lymphoblastic Leukemia-Lymphoma	49	0.0	0.0
Recurrence	33	0.0	0.0
Urinary Bladder Neoplasms	114	0.0	0.0

Disease	Target Count
Adverse reaction to drug	61
Bladder Neoplasm	112
Precursor Cell Lymphoblastic Leukemia Lymphoma	43
nervous system disorder	53

Disease	Target Count
Malignant mesothelioma of pleura	7
non-small cell lung cancer	2890

Disease	Target Count	P-value
Breast cancer	3578	1.8e-14
osteosarcoma	7950	2.1e-10
tuberculosis	2010	7.8e-07
ovarian cancer	8520	7.9e-07
malignant mesothelioma	3232	1.1e-05
sonic hedgehog group medulloblastoma	467	3.8e-04
adult high grade glioma	3801	4.2e-04
psoriasis	6694	5.0e-04
medulloblastoma, large-cell	6241	6.1e-04
intraductal papillary-mucinous neoplasm (IPMN)	3291	1.5e-03
active Crohn's disease	922	2.9e-03
active ulcerative colitis	764	3.7e-03
colon cancer	1478	5.0e-02

Disease	Target Count	Z-score	Confidence
biotin-responsive basal ganglia disease	8	4.278	2.1
Myelomeningocele	16	3.443	1.7
Cancer	2499	3.24	1.6

Differential Expression (13)

Disease	log2 FC	p
active Crohn's disease	-1.144	2.9e-03
active ulcerative colitis	-1.330	3.7e-03
adult high grade glioma	-1.300	4.2e-04
Breast cancer	1.400	1.8e-14
colon cancer	1.300	5.0e-02
intraductal papillary-mucinous neoplasm ...	1.200	1.5e-03
malignant mesothelioma	1.500	1.1e-05
medulloblastoma, large-cell	-1.100	6.1e-04
osteosarcoma	-3.652	2.1e-10
ovarian cancer	1.400	7.9e-07
psoriasis	1.600	5.0e-04
sonic hedgehog group medulloblastoma	1.100	3.8e-04
tuberculosis	1.300	7.8e-07

Lung 18,057

Ovary 17,971

Spleen 17,614

Nerve - Tibial 18,007

Artery - Coronary 17,949

Thyroid 18,024

Artery - Tibial 17,631

Brain - Cerebellum 17,983

Artery - Aorta 17,896

Whole Blood 17,439

Cells - EBV-transformed lymphocytes 18,186

Brain - Cerebellar Hemisphere 18,015

Brain - Cortex 18,039

Vagina 17,834

Uterus 17,618

Brain - Putamen (basal ganglia) 17,863

Small Intestine - Terminal Ileum 17,954

Liver 18,071

Adrenal Gland 18,071

Brain - Caudate (basal ganglia) 18,001

Brain - Frontal Cortex (BA9) 18,069

Adipose - Subcutaneous 18,110

Cells - Transformed fibroblasts 17,577

Prostate 18,213

Brain - Substantia nigra 17,981

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Spinal cord (cervical c-1) 17,973

Testis 18,518

Brain - Hypothalamus 18,169

Adipose - Visceral (Omentum) 17,937

Colon - Sigmoid 18,089

Breast - Mammary Tissue 18,103

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Amygdala 18,006

Pituitary 18,147

Brain - Hippocampus 18,011

Colon - Transverse 17,825

Esophagus - Gastroesophageal Junction 18,000

Esophagus - Muscularis 18,017

Skin - Not Sun Exposed (Suprapubic) 18,081

Stomach 17,879

Kidney - Cortex 17,329

Skin - Sun Exposed (Lower leg) 17,968

Minor Salivary Gland 18,005

Esophagus - Mucosa 18,076

Heart - Atrial Appendage 17,896

Pancreas 18,123

Heart - Left Ventricle 18,006

Muscle - Skeletal 17,778

NK Cells 8,475

Fetal Liver 8,402

CD8 Cells 9,840

Fetal Gut 8,640

Fetal Ovary 9,118

Adult Lung 6,663

Adult Ovary 10,192

Adult Testis 10,836

Adult Pancreas 9,168

Fetal Heart 9,228

Adult Urinary Bladder 7,592

B Cells 9,086

Adult Prostate 8,952

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

Cervical carcinoma cell 4,944

Erythroleukemia cell 4,300

Small intestine 330

Liver 5,008

Lymphoma cell 53

Placenta 3,079

Testis 3,897

Thymus 427

Tongue 470

See source...

REF-52 cell 4

sbc2 7

Neural tube 122

See source...

Synonym

Accession	P41440 B2R7U8 B7Z8C3 E9PFY4 O00553 O60227 Q13026 Q9BTX8 FOLT
Symbols	CHMD FOLT IFC1 REFC RFC1

Gene

SLC19A1

PANTHER Protein Class (1)

transporter 580

Ortholog (13)

Species	Source	Disease
Xenopus 10,463	Inparanoid OMA EggNOG
Zebrafish 9,725	OMA EggNOG
Platypus 5,699	Inparanoid OMA EggNOG
Anole lizard 10,585	Inparanoid OMA EggNOG
Chimp 14,136	OMA EggNOG
Rat 15,112	Inparanoid OMA EggNOG
Dog 15,069	Inparanoid OMA EggNOG
Macaque 12,758	Inparanoid OMA EggNOG
Mouse 16,567	Inparanoid OMA EggNOG
Pig 10,164	Inparanoid OMA EggNOG
Opossum 12,223	OMA EggNOG
Horse 14,249	Inparanoid OMA EggNOG
Cow 15,316	Inparanoid OMA EggNOG

UniProt Keyword (12)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Alternative splicing 10,528

Phosphoprotein 8,216

Glycoprotein 4,623

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

Acetylation 3,409

See all...

GO Function (4)

folic acid binding 11

folic acid transporter activity 6

methotrexate transporter activity 2

reduced folate carrier activity 1

GO Component (4)

plasma membrane 4,414

integral component of plasma membrane 1,418

apical plasma membrane 292

basolateral plasma membrane 184

GO Process (4)

folic acid metabolic process 18

folic acid transport 6

methotrexate transport 2

reduced folate transmembrane transport 1

Compartment GO Term (17)

ATP-binding cassette (ABC) transporter c... 3

Apical part of cell 356

Apical plasma membrane 235

Basolateral plasma membrane 166

Cell 16,178

Cell part 16,177

Cell periphery 5,382

Integral component of membrane 5,331

Integral component of plasma membrane 1,693

Intrinsic component of membrane 5,458

Intrinsic component of plasma membrane 1,749

Membrane 8,531

Membrane part 6,554

Plasma membrane 5,830

Plasma membrane part 2,594

See all...

MGI Phenotype (12)

endocrine-exocrine gland phenotype 2,293

growth-size-body region phenotype 4,157

integument phenotype 1,874

homeostasis-metabolism phenotype 4,747

digestive-alimentary phenotype 1,398

hematopoietic system phenotype 3,383

reproductive system phenotype 1,999

mortality-aging 5,018

liver-biliary system phenotype 1,300

embryo phenotype 1,827

See all...

GWAS Trait (1)

Pursuit maintenance gain 53

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (8)

Antifolate resistance 31

Vitamin digestion and absorption 24

Metabolism 2,081

Metabolism of vitamins and cofactors 188

Metabolism of folate and pterines 16

Metabolism of water-soluble vitamins and... 123

Ethanol effects on histone modifications 31

Folate Metabolism 65

Drug (4)

pemetrexed
pIC50 6.86

raltitrexed
pIC50 8.20

methotrexate
pIC50 7.92

methotrexate
pKi 5.33

Ligand (12)

CHEMBL388501
pKi 6.28

CHEMBL390990
pKi 6.55

CHEMBL3409336
pIC50 6.61

CHEMBL3628344
pIC50 6.71

CHEMBL3628346
pIC50 6.72

CHEMBL3409334
pIC50 6.94

CHEMBL1834488
pIC50 7.00

CHEMBL3407519
pIC50 7.22

CHEMBL3628345
pIC50 7.27

CHEMBL3409335
pIC50 7.42

CHEMBL225071
pIC50 8.20

compound 9 [PMID: 15615544]
pKi 6.55

Gene RIF (159)

AA Sequence

MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITP      1 - 70
VLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYI     71 - 140
FSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLALFLKRPKRSL    141 - 210
FFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAG    211 - 280
YYLVVYYVHILWNEVDPTTNSARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLV    281 - 350
FLLAHTRHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD    351 - 420
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKG    421 - 490
LGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAAD    491 - 560
ETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ                                           561 - 591
//

Text Mined References (173)

Summary
Details

	PMID	Year	Title

Tchem Folate transporter 1 Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent

No data available

TINX Plot

Disease (5)

Expression

Differential Expression (13)

Synonym

Gene

PANTHER Protein Class (1)

Ortholog (13)

UniProt Keyword (12)

GO Function (4)

GO Component (4)

GO Process (4)

Compartment GO Term (17)

MGI Phenotype (12)

GWAS Trait (1)

HCA RNA Cell Line (56)

Pathway (8)

Drug (4)

Ligand (12)

Gene RIF (159)

AA Sequence

Text Mined References (173)

Tchem Folate transporter 1

Add to cart

View Collections

Empty Collection