Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.98
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.287 1.6e-03
group 3 medulloblastoma -2.200 2.1e-03
cystic fibrosis 1.573 7.3e-06
medulloblastoma, large-cell -2.000 3.4e-03
tuberculosis and treatment for 3 months 1.300 2.5e-05
intraductal papillary-mucinous adenoma (... 1.200 1.2e-02
intraductal papillary-mucinous carcinoma... 1.200 2.7e-02
Breast cancer -1.200 1.5e-03
ovarian cancer -2.300 1.1e-05

AA Sequence

MEALGDLEGPRAPGGDDPAGSAGETPGWLSREQVFVLISAASVNLGSMMCYSILGPFFPKEAEKKGASNT      1 - 70
IIGMIFGCFALFELLASLVFGNYLVHIGAKFMFVAGMFVSGGVTILFGVLDRVPDGPVFIAMCFLVRVMD     71 - 140
AVSFAAAMTASSSILAKAFPNNVATVLGSLETFSGLGLILGPPVGGFLYQSFGYEVPFIVLGCVVLLMVP    141 - 210
LNMYILPNYESDPGEHSFWKLIALPKVGLIAFVINSLSSCFGFLDPTLSLFVLEKFNLPAGYVGLVFLGM    211 - 280
ALSYAISSPLFGLLSDKRPPLRKWLLVFGNLITAGCYMLLGPVPILHIKSQLWLLVLILVVSGLSAGMSI    281 - 350
IPTFPEILSCAHENGFEEGLSTLGLVSGLFSAMWSIGAFMGPTLGGFLYEKIGFEWAAAIQGLWALISGL    351 - 420
AMGLFYLLEYSRRKRSKSQNILSTEEERTTLLPNET                                      421 - 456
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19697161 2010 C6ORF192 forms a unique evolutionary branch among solute carriers (SLC16, SLC17, and SLC18) and is abundantly expressed in several brain regions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.