Property Summary

NCBI Gene PubMed Count 25
PubMed Score 486.34
PubTator Score 100.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 5.8e-10
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 4.372 2.2
Dementia 129 3.287 1.6
Neurogenic bladder 16 3.023 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.300 5.8e-10

Gene RIF (16)

PMID Text
24732660 PCMC expression of ADAM29, FLRT2, and SLC18A3 could be assessed as part of a routine screen to help identify individuals at risk of severe Obstructive sleep apnea in Asian populations
24316404 Expression of VAChT is increased in neuronal cell lines following upregulation of Lhx8.
23222296 Data indicate that siRNA-mediated attenuation of vesicular acetylcholine transporter (VAChT, SLC18A3) reversed the apoptotic activity of vesamicol.
22821666 alpha-Synuclein expression in axons to the distal gut correlates closely with expression of the cholinergic marker, VAChT.
21948486 Multiple abnormalities with intellectual and developmental disability result from recurrent deletions and reciprocal duplications of 10q11.21q11.23 including CHAT and SLC18A3.
21163949 overexpressed ChAT enhanced transcription of the CHT1 gene but not the VACHT gene
20831599 Mutations in the vesicular acetylcholine transporter demonstrate decreased affinity for acetylcholine and vesamicol.
20490865 The colocalisation of CHT1 immunoreactivity with VAChT immunoreactivity in cholinergic enteric nerves in the human bowel thus suggests that CHT1 represents another marker of cholinergic nerves.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19685929 Time-dependent dissociation of bound [3H]vesamicol is biphasic, but equilibrium saturation curves are not. The contrasting phasicity suggests that the pathway to and from the [3H]vesamicol binding site exists in open and at least partially closed states.
19204726 Observational study of gene-disease association. (HuGE Navigator)
17373700 Observational study of gene-disease association. (HuGE Navigator)
16763548 presence of VAChT in cutaneous nerves and in both epidermal melanocytes and keratinocytes as well as in their nuclei
14622097 An 11.2 kb transgene (named hV11.2) that spanned about 5 kb upstream of the start of VACHT translation down to the first choline acetyltransferase coding exon gave variable expression in the medial habenular nucleus of transgenic mice
12759818 Observational study of gene-disease association. (HuGE Navigator)
12759818 Three non-coding SNPs were detected in SLC18A3. None demonstrated any reproducible association with late-onset AD in our samples.

AA Sequence

MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGGEG      1 - 70
PTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLFASKAILQLLVNP     71 - 140
LSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPER    141 - 210
SRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGT    211 - 280
PIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAA    281 - 350
RYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV    351 - 420
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPP    421 - 490
QGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS                                491 - 532
//

Text Mined References (28)

PMID Year Title
24732660 Gene expression profiles in peripheral blood mononuclear cells of Asian obstructive sleep apnea patients.
24316404 2014 Upregulation of Lhx8 increase VAChT expression and ACh release in neuronal cell line SHSY5Y.
23222296 2013 Inhibition of cholinergic signaling causes apoptosis in human bronchioalveolar carcinoma.
22821666 2013 Selective expression of ?-synuclein-immunoreactivity in vesicular acetylcholine transporter-immunoreactive axons in the guinea pig rectum and human colon.
21948486 2012 Recurrent deletions and reciprocal duplications of 10q11.21q11.23 including CHAT and SLC18A3 are likely mediated by complex low-copy repeats.
21163949 2011 Nuclear choline acetyltransferase activates transcription of a high-affinity choline transporter.
20831599 2010 Search for the acetylcholine and vesamicol binding sites in vesicular acetylcholine transporter: the region around the lumenal end of the transport channel.
20490865 2010 Immunoreactivity for high-affinity choline transporter colocalises with VAChT in human enteric nervous system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19685929 2009 Multiple protonation states of vesicular acetylcholine transporter detected by binding of [3H]vesamicol.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17092608 2007 SEC14-like protein 1 interacts with cholinergic transporters.
16763548 2006 The vesicular acetylcholine transporter is present in melanocytes and keratinocytes in the human epidermis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622097 2003 Identification of a region from the human cholinergic gene locus that targets expression of the vesicular acetylcholine transporter to a subset of neurons in the medial habenular nucleus in transgenic mice.
12827358 2004 The vesicular amine transporter family (SLC18): amine/proton antiporters required for vesicular accumulation and regulated exocytotic secretion of monoamines and acetylcholine.
12759818 2003 Sequence variation in the CHAT locus shows no association with late-onset Alzheimer's disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417445 2002 Immunochemical and immunocytochemical characterization of cholinergic markers in human peripheral blood lymphocytes.
10883397 2000 Expression of the cholinergic gene locus in pulmonary arterial endothelial cells.
10727789 2000 Somatomotor neuron-specific expression of the human cholinergic gene locus in transgenic mice.
8910293 1996 Active transport of acetylcholine by the human vesicular acetylcholine transporter.
8860234 1995 Human and monkey cholinergic neurons visualized in paraffin-embedded tissues by immunoreactivity for VAChT, the vesicular acetylcholine transporter.
8071310 1994 Functional identification of a vesicular acetylcholine transporter and its expression from a "cholinergic" gene locus.
7616604 1995 Human choline acetyltransferase gene: localization of alternative first exons.