Property Summary

NCBI Gene PubMed Count 28
PubMed Score 94.65
PubTator Score 54.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 6.200 8.5e-08
active Crohn's disease 1.544 8.4e-03
lung carcinoma 3.200 1.4e-55

Gene RIF (19)

PMID Text
26338179 VMAT1 and VMAT2 are expressed in the majority of neuroblastomas
25842846 SLC18A1 gene polymorphisms are associated with the risk of paranoid schizophrenia in Russians and Tatars.
23337945 The data of this study showed that VMAT1 polymorphisms influence monoamine signaling, the functional response of emotional brain circuits and risk for psychopathology.
23090274 Deletion of amino acids 307-338 in hVMAT1 isoform-b abolishes transport activity, and a 136-Thr partially reduces activity of isoform-a.
21883697 we found a significant down-regulation of the gene coding for the vesicular monoamine transporter (VMAT1)in enteroendocrine cells infected with Chlamydia trachomatis
20677014 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18702937 Observational study of gene-disease association. (HuGE Navigator)
18451639 Polymorphism in VMAT1 gene on chromosome 8p is associated with schizophrenia.
18451639 Observational study of gene-disease association. (HuGE Navigator)
18249496 Our findings support the hypothesis that anxiety-related personality traits are associated with variation in the VMAT1/SLC18A1 gene.
18249496 Observational study of gene-disease association. (HuGE Navigator)
17134514 Observational study of gene-disease association. (HuGE Navigator)
16936705 Observational study of gene-disease association. (HuGE Navigator)
16936705 Expression analysis confirmed that VMAT1 is expressed in human brain at the mRNA and protein level. Results suggest that variations in the VMAT1 gene may confer susceptibility to Bipolar Disorder in patients of European descent.
16326835 VMAT1Delta15 is not localized in large, dense core vesicles as the native form but in the endoplasmic reticulum. While VMAT1 can take up serotonin, VMAT1Delta15 cannot, indicating different functions for the two forms of VMAT1.
16189177 Greater expression of VMAT 1 in von Hippel-Lindau syndrome than multiple endocrine neoplasia type 2. Expression of VMAT 2 did not differ significantly.
12807698 Human bronchial arterial smooth muscle cells express OCT-1 and extraneuronal monoamine transporter(EMT). EMT is the predominant plasma membrane transporter for norepinephrine uptake.

AA Sequence

MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSP      1 - 70
HALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVG     71 - 140
VLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVA    141 - 210
GLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQP    211 - 280
SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYL    281 - 350
IGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL    351 - 420
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAI    421 - 490
LSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE                                       491 - 525
//

Text Mined References (30)

PMID Year Title
26338179 2016 Vesicular monoamine transporter protein expression correlates with clinical features, tumor biology, and MIBG avidity in neuroblastoma: a report from the Children's Oncology Group.
25842846 [The association of polymorphisms in SLC18A1, TPH1 and RELN genes with risk of paranoid schizophrenia].
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23337945 2014 Functional genetic variants in the vesicular monoamine transporter 1 modulate emotion processing.
23090274 2012 Thr136Ile polymorphism of human vesicular monoamine transporter-1 (SLC18A1 gene) influences its transport activity in vitro.
21883697 2011 Infection of human enteroendocrine cells with Chlamydia trachomatis: a possible model for pathogenesis in irritable bowel syndrome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
20031538 2008 Genome-wide association analysis of high-density lipoprotein cholesterol in the population-based KORA study sheds new light on intergenic regions.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
18702937 Association study between reward dependence temperament and a polymorphism in the phenylethanolamine N-methyltransferase gene in a Japanese female population.
18451639 2008 Association between polymorphisms in the vesicular monoamine transporter 1 gene (VMAT1/SLC18A1) on chromosome 8p and schizophrenia.
18249496 2008 Association between variation in the vesicular monoamine transporter 1 gene on chromosome 8p and anxiety-related personality traits.
18193046 2008 Genome-wide scan identifies variation in MLXIPL associated with plasma triglycerides.
17134514 2006 Association study of the vesicular monoamine transporter 1 (VMAT1) gene with schizophrenia in a Japanese population.
16936705 2006 Variations in the vesicular monoamine transporter 1 gene (VMAT1/SLC18A1) are associated with bipolar i disorder.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16326835 2005 Identification and characterization of a novel splicing variant of vesicular monoamine transporter 1.
16189177 2005 Different expression of catecholamine transporters in phaeochromocytomas from patients with von Hippel-Lindau syndrome and multiple endocrine neoplasia type 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12871984 2003 Expression of the two isoforms of the vesicular monoamine transporter (VMAT1 and VMAT2) in the endocrine pancreas and pancreatic endocrine tumors.
12827358 2004 The vesicular amine transporter family (SLC18): amine/proton antiporters required for vesicular accumulation and regulated exocytotic secretion of monoamines and acetylcholine.
12807698 2003 Norepinephrine transport by the extraneuronal monoamine transporter in human bronchial arterial smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11431013 2001 Identification of dopamine plasma membrane and vesicular transporters in human peripheral blood lymphocytes.
8643547 1996 Distinct pharmacological properties and distribution in neurons and endocrine cells of two isoforms of the human vesicular monoamine transporter.
7905859 1993 Chromosomal localization of the human vesicular amine transporter genes.