Property Summary

Ligand Count 4
NCBI Gene PubMed Count 31
PubMed Score 96.17
PubTator Score 54.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.544 8.4e-03
lung cancer 1.800 1.3e-03
lung carcinoma 3.200 1.4e-55

Gene RIF (22)

AA Sequence

MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSP      1 - 70
HALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVG     71 - 140
VLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVA    141 - 210
GLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQP    211 - 280
SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYL    281 - 350
IGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL    351 - 420
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAI    421 - 490
LSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE                                       491 - 525
//

Text Mined References (33)

PMID Year Title