Property Summary

NCBI Gene PubMed Count 22
PubMed Score 322.01
PubTator Score 91.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -3.800 4.3e-03
ependymoma -3.900 1.7e-17
oligodendroglioma -3.500 5.1e-21
glioblastoma -4.700 4.5e-13
osteosarcoma 2.863 7.1e-08
sonic hedgehog group medulloblastoma -3.500 2.2e-04
atypical teratoid / rhabdoid tumor -4.700 3.2e-19
medulloblastoma, large-cell -2.400 3.7e-04
primitive neuroectodermal tumor -4.400 5.9e-06
pediatric high grade glioma -3.600 2.6e-06
pilocytic astrocytoma -3.900 2.2e-07
subependymal giant cell astrocytoma -3.893 5.0e-02
Pick disease -1.900 2.8e-02
ovarian cancer 1.300 6.9e-10
psoriasis -1.300 2.1e-41

Gene RIF (14)

PMID Text
25749033 Loss of SLC17A7 expression is associated with glioblastoma.
23022470 Depressed patients showed significant decreases in synaptophysin (SYN) and VGLUT1 expression, whereas in bipolar patients, decreases in VGLUT1 expression have also been found.
22510271 Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
21396926 We examined the ratio of excitatory to inhibitory vesicular neurotransmitter transporter mRNAs (VGluT1 to VGAT) and their ratio in the dorsolateral prefrontal cortex during normal human development and in people with schizophrenia
19839996 This study found decreased VGLUT1 mRNA expression in both major depressive disorder and bipolar disorder in the entorhinal cortex.
19720501 this study suggests that the common genetic variants of the VGLUT1 gene appear not play a major role in conferring susceptibility to schizophrenia in Han population of Taiwan.
19720501 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18155679 We found increased VGLUT1 transcript and reduced VGLUT1 protein expression in the ACC, but not DLPFC, in schizophrenia.
17660252 Docking and homology modeling explain the inhibition of VGLUT1.
17531353 Our results suggest that VGLUT1 expression in the prefrontal cortex could be used as a valuable neurochemical marker of dementia in AD.
15961236 Alterations in the pattern of vesicular glutamate transporter 1-immunoreactivity that perfectly matched the neuronal loss and gliosis, as well as the decrease in the number of asymmetrical synapses identified by electron microscopy in this tissue
15653259 In schizophrenia, VGLUT1 mRNA was decreased in hippocampal formation and dorsolateral prefrontal cortex. In the hippocampus, the loss of VGLUT1 mRNA supports data indicating that glutamatergic presynaptic deficits are prominent.

AA Sequence

MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSG      1 - 70
LGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQK     71 - 140
FAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTA    141 - 210
FCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGE    211 - 280
SAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLV    281 - 350
MTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS    351 - 420
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFA    421 - 490
SGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY    491 - 560
//

Text Mined References (24)

PMID Year Title
25749033 2015 Global analysis of H3K4me3 and H3K27me3 profiles in glioblastoma stem cells and identification of SLC17A7 as a bivalent tumor suppressor gene.
23022470 2012 Alterations in the expression of PSA-NCAM and synaptic proteins in the dorsolateral prefrontal cortex of psychiatric disorder patients.
22510271 2012 Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
21396926 2011 Expression of VGluT1 and VGAT mRNAs in human dorsolateral prefrontal cortex during development and in schizophrenia.
19839996 2009 Vesicular glutamate transporter mRNA expression in the medial temporal lobe in major depressive disorder, bipolar disorder, and schizophrenia.
19720501 2009 Resequencing and association study of vesicular glutamate transporter 1 gene (VGLUT1) with schizophrenia.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18155679 2008 Altered vesicular glutamate transporter expression in the anterior cingulate cortex in schizophrenia.
17660252 2007 Docking and homology modeling explain inhibition of the human vesicular glutamate transporters.
17531353 2008 Loss of VGLUT1 and VGLUT2 in the prefrontal cortex is correlated with cognitive decline in Alzheimer disease.
16606361 2006 Interaction between the vesicular glutamate transporter type 1 and endophilin A1, a protein essential for endocytosis.
15961236 2005 Vesicular glutamate transporter 1 immunostaining in the normal and epileptic human cerebral cortex.
15653259 2005 Decreased expression of vesicular glutamate transporter 1 and complexin II mRNAs in schizophrenia: further evidence for a synaptic pathology affecting glutamate neurons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11001057 2000 Identification of a vesicular glutamate transporter that defines a glutamatergic phenotype in neurons.
10938000 2000 Uptake of glutamate into synaptic vesicles by an inorganic phosphate transporter.
10820226 2000 Molecular cloning of a novel brain-type Na(+)-dependent inorganic phosphate cotransporter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8632143 1996 Molecular cloning, expression, and chromosomal localization of a human brain-specific Na(+)-dependent inorganic phosphate cotransporter.