Property Summary

NCBI Gene PubMed Count 23
PubMed Score 343.90
PubTator Score 92.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -3.600 8.0e-03
ependymoma -4.700 3.6e-16
oligodendroglioma -3.500 1.7e-02
glioblastoma -3.700 1.0e-03
osteosarcoma -1.264 1.5e-03
atypical teratoid / rhabdoid tumor -3.000 6.3e-03
pediatric high grade glioma -3.700 1.7e-04
pilocytic astrocytoma -4.800 5.4e-08
non primary Sjogren syndrome sicca -1.200 3.0e-02
lung carcinoma 3.700 8.9e-16
ovarian cancer -1.500 1.7e-08

Gene RIF (17)

PMID Text
26439639 Vglut2 and oligodendrocyte progenitor cells co-localize in multiple sclerosis lesions, supporting evidence that neuronal activity and release of glutamate instruct OPCs to differentiate into new myelinating oligodendrocytes that recover lost function.
26386900 This study demonstrated that Protein levels of vGLUT2 were significantly increased in schizophrenia subjects compared to controls.
25319702 Itch is regulated by VGLUT2-mediated transmission in neurons via Trpv1.
25319687 There is a glutamatergic signal from ventral tegmental area VGluT2-habenular neurons that plays a role in aversive conditioning.
22684983 This study demonistrated that Distribution of vesicular glutamate transporter 2 (VGluT2) in the primary visual cortex(V1 area)
22510271 Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
20541370 This study may lend support to the multiple rare mutations hypothesis of schizophrenia, and may provide genetic clues to indicate the involvement of the glutamate transmission pathway in the pathogenesis of schizophrenia.
20541370 Observational study of gene-disease association. (HuGE Navigator)
20540360 Observational study of gene-disease association. (HuGE Navigator)
19839996 This study decreased VGLUT2 mRNA expression in major depressive disorder in the middle temporal gyrus, and increased VGLUT2 mRNA expression in schizophrenia in the inferior temporal gyrus.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18562601 VGluT2 is the only vesicular glutamate transporter expressed in transgenic ventral tegmental area/substantia nigra dopamine neurons in vivo.
18155679 Vesicular glutamate transporter 2 was unchanged at both levels of gene expression.
18050306 higher in tendinosis tendons compared to normal tendons
17660252 Docking and homology modeling explain the inhibition of VGLUT2.
17531353 Our results suggest that VGLUT1 expression in the prefrontal cortex could be used as a valuable neurochemical marker of dementia in AD.

AA Sequence

MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLCDCTCFGLPRR      1 - 70
YIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWDPETVGMIHGSFFWGYIITQI     71 - 140
PGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLE    141 - 210
RSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERR    211 - 280
YIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGM    281 - 350
LSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV    351 - 420
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGG    421 - 490
VIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEK    491 - 560
KEEFVQGEVQDSHSYKDRVDYS                                                    561 - 582
//

Text Mined References (27)

PMID Year Title
26439639 2015 Neuronal activity regulates remyelination via glutamate signalling to oligodendrocyte progenitors.
26386900 2015 Uncovering the role of the nucleus accumbens in schizophrenia: A postmortem analysis of tyrosine hydroxylase and vesicular glutamate transporters.
25319702 2014 Multimodal use of calcitonin gene-related peptide and substance P in itch and acute pain uncovered by the elimination of vesicular glutamate transporter 2 from transient receptor potential cation channel subfamily V member 1 neurons.
25319687 2014 Role of glutamatergic projections from ventral tegmental area to lateral habenula in aversive conditioning.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22684983 2013 Distribution of vesicular glutamate transporter 2 (VGluT2) in the primary visual cortex of the macaque and human.
22510271 2012 Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
20541370 2010 Resequencing of the vesicular glutamate transporter 2 gene (VGLUT2) reveals some rare genetic variants that may increase the genetic burden in schizophrenia.
20540360 2010 [A study of the single nucleotide polymorphism in seven genes (GHR, IGFBP3, IGFR1, IRS1, FMN1, ANXA2, TaGLN) in ethnic Russians and in patients with prostate cancer].
19839996 2009 Vesicular glutamate transporter mRNA expression in the medial temporal lobe in major depressive disorder, bipolar disorder, and schizophrenia.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18562601 2008 Developmental and target-dependent regulation of vesicular glutamate transporter expression by dopamine neurons.
18155679 2008 Altered vesicular glutamate transporter expression in the anterior cingulate cortex in schizophrenia.
18050306 2008 VGluT2 expression in painful Achilles and patellar tendinosis: evidence of local glutamate release by tenocytes.
17660252 2007 Docking and homology modeling explain inhibition of the human vesicular glutamate transporters.
17531353 2008 Loss of VGLUT1 and VGLUT2 in the prefrontal cortex is correlated with cognitive decline in Alzheimer disease.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15124103 2004 The novel gene encoding a putative transmembrane protein is mutated in gnathodiaphyseal dysplasia (GDD).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698620 2001 Identification of differentiation-associated brain-specific phosphate transporter as a second vesicular glutamate transporter (VGLUT2).
11306821 2001 Assignment of SLC17A6 (alias DNPI), the gene encoding brain/pancreatic islet-type Na+-dependent inorganic phosphate cotransporter to human chromosome 11p14.3.
10820226 2000 Molecular cloning of a novel brain-type Na(+)-dependent inorganic phosphate cotransporter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.