Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.39
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.220 1.4e-05
atypical teratoid / rhabdoid tumor 1.200 8.5e-03
medulloblastoma, large-cell 1.900 2.8e-05
intraductal papillary-mucinous adenoma (... -1.900 5.6e-04
intraductal papillary-mucinous neoplasm ... -1.900 8.6e-03
colon cancer -2.000 3.8e-05
pancreatic cancer -1.300 2.1e-04
adult high grade glioma 1.200 6.2e-03
ulcerative colitis -2.700 6.4e-08
ovarian cancer 1.200 9.1e-11

Gene RIF (2)

PMID Text
22460716 SLC17A4 is an intestinal organic anion exporter that acts in delta-psi and Chloride dependent manners
19460752 Knockdown of solute carrier family 17 (sodium phosphate), member 4 (SLC17A4; KAIA2138) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MSTGPDVKATVGDISSDGNLNVAQEECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIAIPAMVNNTAP      1 - 70
PSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYV     71 - 140
VGAGLFISSFLTLFIPLAANAGVALLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQLTTIAGSGSML    141 - 210
GSFIVLLAGGLLCQTIGWPYVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLAQQDCSPG    211 - 280
WSLPIRAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL    281 - 350
LADFLLSRKILRLITIRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDI    351 - 420
APRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFGWRNVFLLSAAVNISGLVFYLIFGRADVQDWAK    421 - 490
EQTFTHL                                                                   491 - 497
//

Text Mined References (10)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
22460716 2012 A Na+-phosphate cotransporter homologue (SLC17A4 protein) is an intestinal organic anion exporter.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21909108 2011 Meta-analysis of genome-wide association studies from the CHARGE consortium identifies common variants associated with carotid intima media thickness and plaque.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12672655 2003 Kinetic evidence that the Na-PO4 cotransporter is the molecular mechanism for Na/Li exchange in human red blood cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10319585 1999 Isolation and chromosomal mapping of a novel human gene showing homology to Na+/PO4 cotransporter.