Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.18
PubTator Score 12.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
nephrosclerosis -1.784 3.4e-02
glioblastoma 1.100 4.4e-04
medulloblastoma, large-cell 1.100 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.230 2.7e-03

Gene RIF (13)

PMID Text
21778665 hNPT4 (SLC17A3) mediated time- and concentration-dependent uptake of OTxA (K(m): 802.8 microM) in a pH- and voltage-sensitive manner.
21282933 variants carrying SNP V257F, G279R, or P378L exhibited reduced transport of para-aminohippurate, bumetanide, estrone and urate; SNPs may contribute to inter-individual differences in disposition of anionic drugs and certain endogenous organic anions
20810651 a model of urate secretion in the renal tubular cell, where intracellular urate taken up via OAT1 and/or OAT3 from the blood exits from the cell into the lumen via hNPT4.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20162743 SLC17A3 seems to have a major role in determination of serum uric acid repeated measurements variation.
20162743 Observational study of gene-disease association. (HuGE Navigator)
20053405 Genetic variants within SLC2A9,ABCG2 and SLC17A3 are associated with uric acid levels
20053405 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18834626 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15505377 mutation reduces the phosphate transport efficiency, possibly modulating the G6-Pase complex

AA Sequence

MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMNITMVAMVNST      1 - 70
SPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQERSRLCSIALSGMLLGCFTAI     71 - 140
LIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIK    141 - 210
AMLRSLPIWSICLGCFSHQWLVSTMVVYIPTYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLL    211 - 280
TKKFRLITVRKIATILGSLPSSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSF    281 - 350
LMGASRGFSSIAPVIVPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL    351 - 420
//

Text Mined References (23)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
21778665 2011 A novel human organic anion transporter NPT4 mediates the transport of ochratoxin A.
21282933 2011 Functional analysis of human sodium-phosphate transporter 4 (NPT4/SLC17A3) polymorphisms.
20810651 2010 Human sodium phosphate transporter 4 (hNPT4/SLC17A3) as a common renal secretory pathway for drugs and urate.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20162743 2010 Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
20053405 2010 Sex and age interaction with genetic association of atherogenic uric acid concentrations.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
18834626 2008 Association of three genetic loci with uric acid concentration and risk of gout: a genome-wide association study.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15505377 2004 NPT4, a new microsomal phosphate transporter: mutation analysis in glycogen storage disease type Ic.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.