Property Summary

NCBI Gene PubMed Count 10
PubMed Score 33.55
PubTator Score 14.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Age related macular degeneration 72
Disease Target Count P-value
facioscapulohumeral dystrophy 288 8.6e-03
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Atypical depressive disorder 6 3.669 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 8.6e-03

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MGAGGPRRGEGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRALMRDFDAGYSDTAWVSSIMLAMLYG      1 - 70
TGPVSSILVTRFGCRPVMLAGGLLASAGMILASFATRLLELYLTAGVLTGLGLALNFQPSLIMLGLYFER     71 - 140
RRPLANGLAAAGSPVFLSALSPLGQQLLERFGWRGGFLLLGGLLLHCCACGAVMRPPPGPGPRPRRDSAG    141 - 210
DRAGDAPGEAEADGAGLQLREASPRVRPRRRLLDLAVCTDRAFAVYAVTKFLMALGLFVPAILLVNYAKD    211 - 280
AGVPDTDAAFLLSIVGFVDIVARPACGALAGLARLRPHVPYLFSLALLANGLTDLSSARARSYGALVAFC    281 - 350
VAFGLSYGMVGALQFEVLMAAVGAPRFPSALGLVLLVEAAAVLIGPPSAGRLVDVLKNYEIIFYLAGSEV    351 - 420
ALAGVFMAVATNCCLRCAKAAPSGPGTEGGASDTEDAEAEGDSEPLPVVAEEPGNLEALEVLSARGEPTE    421 - 490
PEIEARPRLAAESV                                                            491 - 504
//

Text Mined References (10)

PMID Year Title