Property Summary

Ligand Count 1
NCBI Gene PubMed Count 30
PubMed Score 92.96
PubTator Score 45.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.033 1.3e-02
active ulcerative colitis 2.171 2.7e-02
adult high grade glioma -1.600 7.5e-03
astrocytic glioma -1.900 1.8e-02
Atopic dermatitis -1.300 3.5e-03
atypical teratoid / rhabdoid tumor -2.700 5.6e-09
breast carcinoma -1.300 1.2e-03
colon cancer -1.400 9.6e-03
ductal carcinoma in situ -2.500 1.3e-04
ependymoma -2.100 2.6e-02
fibroadenoma -1.500 4.0e-02
gastric carcinoma -2.700 3.9e-02
glioblastoma -1.200 5.3e-03
group 4 medulloblastoma 1.100 2.9e-02
invasive ductal carcinoma -3.700 1.0e-04
lung cancer -3.000 1.0e-02
medulloblastoma, large-cell -2.300 1.7e-03
nasopharyngeal carcinoma -1.100 2.2e-03
osteosarcoma 2.373 5.8e-04
ovarian cancer -2.100 7.8e-08
Pick disease 1.900 5.4e-03
primitive neuroectodermal tumor -1.800 1.6e-02
psoriasis -1.100 2.3e-06
Rheumatoid arthritis 2.500 4.5e-03
spina bifida -1.516 3.9e-02
tuberculosis 1.100 9.2e-05
urothelial carcinoma -1.800 3.3e-02

Gene RIF (20)

AA Sequence

MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAWISSIMLAVMY      1 - 70
AGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFITGLGLAFNLQPALTIIGKYFY     71 - 140
RKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLILGSLLLNACVAGSLMRPLGPNQTTSKSKNK    141 - 210
TGKTEDDSSPKKIKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEY    211 - 280
SAAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLG    281 - 350
FGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW    351 - 420
LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI                421 - 478
//

Text Mined References (33)

PMID Year Title