Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.36
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -3.077 1.4e-04
glioblastoma -1.100 4.0e-02
medulloblastoma, large-cell -1.500 2.4e-03
primitive neuroectodermal tumor -1.500 2.0e-03
Amyotrophic Lateral Sclerosis 1.064 1.1e-05
acute quadriplegic myopathy 2.932 7.4e-11
tuberculosis -1.300 1.5e-02
non-small cell lung cancer -1.461 7.1e-10
pancreatic cancer 1.300 1.5e-03
breast carcinoma 1.300 3.2e-12
interstitial cystitis 2.300 3.8e-03
adult high grade glioma -1.100 7.9e-03
psoriasis 1.700 1.7e-91
invasive ductal carcinoma 2.500 1.8e-02
progressive supranuclear palsy -1.200 7.2e-03
mucosa-associated lymphoid tissue lympho... 1.488 1.6e-02
ulcerative colitis 1.600 5.1e-03
ovarian cancer 1.100 7.6e-03
facioscapulohumeral dystrophy 2.600 3.6e-06

Gene RIF (3)

PMID Text
24663101 Depletion of the SLC16A6 expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
23333304 Depletion of the SLC16A6 expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
16174808 MCT6 is involved in the disposition of various drugs, including bumetanide.

AA Sequence

MTQNKLKLCSKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSRISWIISIC      1 - 70
VFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVAIGIISGLGYCFSFLPTVTIL     71 - 140
SQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPAS    141 - 210
PKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKK    211 - 280
APLLDFSILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFV    281 - 350
LNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSS    351 - 420
AAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFYSCAAGMALAAVCLALVRPCKMGLCQHHHSGETKVV    421 - 490
SHRGKTLQDIPEDFLEMDLAKNEHRVHVQMEPV                                         491 - 523
//

Text Mined References (9)

PMID Year Title
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16174808 2005 Functional characterization of human monocarboxylate transporter 6 (SLC16A5).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10510291 1999 The proton-linked monocarboxylate transporter (MCT) family: structure, function and regulation.
9425115 1998 Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past.