Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.97
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -1.155 1.3e-02
Chronic Lymphocytic Leukemia 1.141 2.5e-05
chronic rhinosinusitis -1.183 5.8e-03
interstitial cystitis -1.400 1.5e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.4e-02
lung adenocarcinoma -1.500 2.0e-06
lung carcinoma -1.300 1.6e-27
nasopharyngeal carcinoma -1.600 7.7e-09
non-small cell lung cancer -1.121 9.7e-14
osteosarcoma -1.143 3.6e-05
ovarian cancer -1.100 5.2e-05
pancreatic cancer 1.300 7.0e-04
tuberculosis 1.400 8.1e-05
ulcerative colitis -1.400 1.2e-04

Gene RIF (2)

AA Sequence

MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLC      1 - 70
SILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLA     71 - 140
NALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPET    141 - 210
PALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISII    211 - 280
GFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIF    281 - 350
QVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQ    351 - 420
KKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKA    421 - 490
VLQAKQTALGWNSPT                                                           491 - 505
//

Text Mined References (10)

PMID Year Title