Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.42
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
chronic lymphocytic leukemia 1.141 2.5e-05
osteosarcoma -1.878 1.2e-07
tuberculosis 1.400 8.1e-05
non-small cell lung cancer -1.548 1.1e-15
intraductal papillary-mucinous neoplasm ... 1.600 4.4e-02
active Crohn's disease -1.155 1.3e-02
pancreatic cancer 1.300 7.0e-04
interstitial cystitis -2.300 3.7e-04
lung adenocarcinoma -1.500 2.0e-06
nasopharyngeal carcinoma -1.600 7.7e-09
lung carcinoma -1.300 1.6e-27
ulcerative colitis -1.400 1.2e-04
ovarian cancer -1.900 1.8e-07
chronic rhinosinusitis -1.183 5.8e-03

Gene RIF (1)

PMID Text
22911660 We demonstrated that SLC16A5 and ZNF206 displayed altered methylation patterns in the neuroblastoma genome

AA Sequence

MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLC      1 - 70
SILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLA     71 - 140
NALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPET    141 - 210
PALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISII    211 - 280
GFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIF    281 - 350
QVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQ    351 - 420
KKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKA    421 - 490
VLQAKQTALGWNSPT                                                           491 - 505
//

Text Mined References (9)

PMID Year Title
22911660 2013 Identification of aberrant methylation regions in neuroblastoma by screening of tissue-specific differentially methylated regions.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16174808 2005 Functional characterization of human monocarboxylate transporter 6 (SLC16A5).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10510291 1999 The proton-linked monocarboxylate transporter (MCT) family: structure, function and regulation.
9425115 1998 Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past.