Property Summary

NCBI Gene PubMed Count 76
PubMed Score 1.61
PubTator Score 48.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.366 1.3e-02
active ulcerative colitis 2.209 1.7e-02
adult high grade glioma 2.100 2.7e-04
astrocytoma 1.100 6.4e-09
Astrocytoma, Pilocytic 2.000 3.3e-06
Breast cancer -1.900 2.1e-06
ependymoma 3.100 1.3e-14
glioblastoma 1.800 1.4e-04
group 4 medulloblastoma 3.100 3.2e-09
interstitial cystitis 1.400 2.8e-03
lung carcinoma -1.800 1.0e-17
malignant mesothelioma -1.700 3.4e-07
non-small cell lung cancer -1.696 3.9e-11
ovarian cancer -1.900 4.0e-09
pancreatic cancer 1.400 1.2e-03
pituitary cancer -1.100 4.2e-07

Gene RIF (66)

AA Sequence

MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLR      1 - 70
FCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYF     71 - 140
KKRLALSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPIHIKSENNSGIKD    141 - 210
KGSSLSAHGPEAHATETHCHETEESTIKDSTTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSDEESD    211 - 280
KVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS    281 - 350
QIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRN    351 - 420
STVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT       421 - 487
//

Text Mined References (78)

PMID Year Title