Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.31
PubTator Score 76.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma -2.200 7.1e-08
cutaneous lupus erythematosus 1.600 1.7e-04
glioblastoma multiforme 1.900 1.8e-13
osteosarcoma 1.650 2.5e-02
posterior fossa group A ependymoma 1.500 5.9e-05
group 4 medulloblastoma -1.800 1.7e-03
periodontitis 1.100 1.6e-23
Duchenne muscular dystrophy -1.054 1.7e-02
autosomal dominant Emery-Dreifuss muscul... -1.479 3.1e-02
juvenile dermatomyositis -1.080 1.5e-04
acute quadriplegic myopathy -1.444 9.5e-03
Atopic dermatitis 1.500 1.2e-04
tuberculosis and treatment for 6 months -3.400 2.2e-05
primary pancreatic ductal adenocarcinoma 2.322 1.7e-02
non-small cell lung cancer 1.282 6.1e-09
intraductal papillary-mucinous neoplasm ... 1.700 3.7e-03
lung cancer 1.100 5.0e-03
colon cancer 1.300 7.3e-04
active ulcerative colitis 1.946 2.1e-02
pancreatic cancer 2.700 2.0e-07
breast carcinoma 1.300 3.6e-18
pediatric high grade glioma 1.900 3.3e-04
lung adenocarcinoma 1.600 1.8e-07
invasive ductal carcinoma 2.700 8.5e-05
psoriasis -1.100 4.1e-04
Endometriosis -1.231 2.5e-02
inflammatory breast cancer 3.000 1.1e-04
gastric carcinoma 2.100 1.8e-02
ductal carcinoma in situ 1.500 1.3e-03
ovarian cancer 2.400 4.6e-04
pituitary cancer -1.300 5.9e-03

Synonym

Accession O15427 B3KXG8 Q2M1P8 MCT 4
Symbols MCT3
MCT4
MCT 3
MCT 4
MCT-3
MCT-4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20035863 Ocular absorption of monocarboxylic acid drugs may be enhanced by MCT transporter SLC16A3, and the absorption route provided by the transporter may be utilized to improve the bioavailability of topically applied ophthalmic drugs.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17502341 Gamma-hydroxybutyric acid (GHB) is a substrate for both MCT2 and MCT4.

AA Sequence

MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAM      1 - 70
LYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRY     71 - 140
FSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPLVVTAQPGSGP    141 - 210
PRPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPA    211 - 280
AGFVAGLGKVRPYSVYLFSFSMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTH    281 - 350
KFSSAIGLVLLMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE    351 - 420
VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV                             421 - 465
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20035863 2010 Monocarboxylate transport in human corneal epithelium and cell lines.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17502341 2007 The role of monocarboxylate transporter 2 and 4 in the transport of gamma-hydroxybutyric acid in mammalian cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15917240 2005 Basigin (CD147) is the target for organomercurial inhibition of monocarboxylate transporter isoforms 1 and 4: the ancillary protein for the insensitive MCT2 is EMBIGIN (gp70).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12657613 2003 Polarized expression of monocarboxylate transporters in human retinal pigment epithelium and ARPE-19 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10921872 2000 CD147 is tightly associated with lactate transporters MCT1 and MCT4 and facilitates their cell surface expression.
10510291 1999 The proton-linked monocarboxylate transporter (MCT) family: structure, function and regulation.
9425115 1998 Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7273846 1981 The glucose-lactic acid cycle and gluconeogenesis.