Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.88
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
urothelial carcinoma 1.600 2.6e-02
astrocytic glioma -1.400 1.6e-02
glioblastoma -2.300 6.0e-04
osteosarcoma -1.789 1.4e-02
atypical teratoid / rhabdoid tumor -1.200 6.4e-03
medulloblastoma, large-cell -2.000 6.6e-07
Atopic dermatitis 1.300 1.1e-03
non-small cell lung cancer 1.332 3.2e-05
intraductal papillary-mucinous adenoma (... -2.500 1.7e-03
intraductal papillary-mucinous carcinoma... -2.800 1.4e-03
cystic fibrosis 3.800 3.3e-06
pediatric high grade glioma -1.800 1.1e-04
acute myeloid leukemia -1.500 1.1e-02
ulcerative colitis 2.500 1.1e-03
pituitary cancer 2.000 1.4e-06

AA Sequence

MYTSHEDIGYDFEDGPKDKKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRG      1 - 70
LTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGM     71 - 140
AYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMR    141 - 210
PLSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCAL    211 - 280
RILKTVSWLTMRVRKGFEDWYSGYFGTASLFTNRMFVAFIFWALFAYSSFVIPFIHLPEIVNLYNLSEQN    281 - 350
DVFPLTSIIAIVHIFGKVILGVIADLPCISVWNVFLLANFTLVLSIFILPLMHTYAGLAVICALIGFSSG    351 - 420
YFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDITQKYDFSFYICGLLYMIGILFLLI    421 - 490
QPCIRIIEQSRRKYMDGAHV                                                      491 - 510
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.