Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.87
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (1)

PMID Text
23945395 Data identified three new loci for type 2 diabetes with genome-wide significance: MIR129-LEP, GPSM1 and SLC16A13.

AA Sequence

MARRTEPPDGGWGWVVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASIGIAVQQFGSPVG      1 - 70
SALSTKFGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWALTFAPTLACLSCYFSRRRSLA     71 - 140
TGLALTGVGLSSFTFAPFFQWLLSHYAWRGSLLLVSALSLHLVACGALLRPPSLAEDPAVGGPRAQLTSL    141 - 210
LHHGPFLRYTVALTLINTGYFIPYLHLVAHLQDLDWDPLPAAFLLSVVAISDLVGRVVSGWLGDAVPGPV    211 - 280
TRLLMLWTTLTGVSLALFPVAQAPTALVALAVAYGFTSGALAPLAFSVLPELIGTRRIYCGLGLLQMIES    281 - 350
IGGLLGPPLSGYLRDVTGNYTASFVVAGAFLLSGSGILLTLPHFFCFSTTTSGPQDLVTEALDTKVPLPK    351 - 420
EGLEED                                                                    421 - 426
//

Text Mined References (5)

PMID Year Title
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.