Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.35
PubTator Score 6.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.4e-44
Disease Target Count Z-score Confidence
diabetes mellitus 1728 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.4e-44

Gene RIF (4)

AA Sequence

MPAPQRKHRRGGFSHRCFPTPQTAMTPQPAGPPDGGWGWVVAAAAFAINGLSYGLLRSLGLAFPDLAEHF      1 - 70
DRSAQDTAWISALALAVQQAASPVGSALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAG     71 - 140
FGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPC    141 - 210
GALLLPLVLPGDPPAPPRSPLAALGLSLFTRRAFSIFALGTALVGGGYFVPYVHLAPHALDRGLGGYGAA    211 - 280
LVVAVAAMGDAGARLVCGWLADQGWVPLPRLLAVFGALTGLGLWVVGLVPVVGGEESWGGPLLAAAVAYG    281 - 350
LSAGSYAPLVFGVLPGLVGVGGVVQATGLVMMLMSLGGLLGPPLSGFLRDETGDFTASFLLSGSLILSGS    351 - 420
FIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC                       421 - 471
//

Text Mined References (9)

PMID Year Title