Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.54
PubTator Score 43.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (6)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10) in peptide-treated PBMCs
21508134 The strong expression of MCT10 and OATP1C1 in the human hypothalamus indicates a possible role in the regulation of the hypothalamus-pituitary-thyroid axis.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
21315799 monocarboxylate transporter 10 facilitates bromoacetyl [(125)I] iodothyronine transport, but is not labeled by it
20167367 Increased MCT8 and decreased MCT10 expression within placentae of pregnancies complicated by IUGR may contribute to aberrant development of the fetoplacental unit.
18337592 MCT10 is at least as active a thyroid hormone transporter as hMCT8, and that both transporters facilitate iodothyronine uptake as well as efflux.

AA Sequence

MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWG      1 - 70
WLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFG     71 - 140
CRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGS    141 - 210
SVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPK    211 - 280
KIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIA    281 - 350
DYVPGVKKVYLQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI    351 - 420
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKME    421 - 490
KMLENQNSLLSSSSGMFKKESDSII                                                 491 - 515
//

Text Mined References (20)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21508134 2011 Expression of thyroid hormone transporters in the human hypothalamus.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21315799 2011 The thyroid hormone transporters MCT8 and MCT10 transport the affinity-label N-bromoacetyl-[(125)I]T3 but are not modified by it.
20167367 2010 Expression of thyroid hormone transporters in the human placenta and changes associated with intrauterine growth restriction.
18337592 2008 Effective cellular uptake and efflux of thyroid hormone by human monocarboxylate transporter 10.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
15918515 2005 Reabsorption of neutral amino acids mediated by amino acid transporter LAT2 and TAT1 in the basolateral membrane of proximal tubule.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827462 2002 The human T-type amino acid transporter-1: characterization, gene organization, and chromosomal location.
11278976 2001 Tat1, a novel sulfate transporter specifically expressed in human male germ cells and potentially linked to rhogtpase signaling.
11278508 2001 Expression cloning of a Na+-independent aromatic amino acid transporter with structural similarity to H+/monocarboxylate transporters.