Property Summary

NCBI Gene PubMed Count 111
PubMed Score 263.69
PubTator Score 285.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0
Disease Target Count Z-score Confidence
Hypoglycemia 81 3.486 1.7
Hyperinsulinism 63 3.418 1.7
Cancer 2346 3.404 1.7

Expression

  Differential Expression (32)

Disease log2 FC p
pancreatic cancer 1.400 6.5e-04
ependymoma 1.600 2.3e-02
Barrett's esophagus 1.300 2.4e-02
esophageal adenocarcinoma 1.900 1.8e-02
psoriasis 1.600 6.0e-08
cutaneous lupus erythematosus 1.500 1.4e-03
glioblastoma multiforme 1.500 6.5e-18
osteosarcoma 3.165 3.7e-06
astrocytoma 1.200 3.3e-02
atypical teratoid / rhabdoid tumor 1.300 1.8e-03
medulloblastoma, large-cell 2.000 3.8e-05
hereditary spastic paraplegia -1.335 4.6e-03
adrenocortical carcinoma 1.136 2.1e-02
primary pancreatic ductal adenocarcinoma 1.044 1.1e-02
non-small cell lung cancer 2.372 1.6e-14
intraductal papillary-mucinous carcinoma... 2.000 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.300 9.1e-03
X-linked cerebral adrenoleukodystrophy 1.100 4.9e-02
colon cancer -1.800 2.5e-02
lung cancer 4.800 5.9e-06
active Crohn's disease -1.993 2.5e-02
ulcerative colitis -2.700 9.5e-06
interstitial cystitis 1.200 3.7e-03
group 3 medulloblastoma 1.100 4.5e-02
pancreatic carcinoma 1.200 2.1e-03
nasopharyngeal carcinoma 1.300 8.6e-03
Endometriosis -1.336 3.0e-02
invasive ductal carcinoma -1.100 4.0e-02
ovarian cancer -3.700 1.7e-08
Breast cancer 1.300 9.6e-04
Down syndrome 1.500 3.6e-03
dermatomyositis -1.300 9.7e-03

Gene RIF (86)

PMID Text
26876179 MCT1 inhibition impairs proliferation of glycolytic breast cancer cells co-expressing MCT1 and MCT4 via disruption of pyruvate rather than lactate export.
26779534 MCT1 expression was not clearly associated with overall or disease-free survival. MCT4 and CD147 expression correlate with worse prognosis across many cancer types. These results warrant further investigation of these associations.
26615136 MCT1 is highly expressed in anaplastic thyroid cancer compared to non-cancerous thyroid tissue and papillary thyroid cancer.
26595136 The most important finding from the present study was that wild-type allele carriers, 2917(1414)T and IVS3-17C, have been associated with higher blood lactate levels at submaximal intensities of exercise for the first time.
26539827 MCT1 and GLUT1 may be potential prognostic markers in adenocarcinoma.
26045776 Down regulation of MCT1 promote the sensitivity to cisplatin in ovarian cancer cells. This effect appeared to be mediated by antagonizing Fas.
26024713 interaction of rmEMMPRINex with U937 cells leads to inhibition of MCT1 membrane expression, intracellular activation of procaspase-9, followed by DNA fragmentation and apoptosis.
25957999 The first IF method has been developed and optimised for detection of MCT 1 and MCT4 in cancer patient circulating tumour cells
25755717 CD147 interacts with MCT1 to regulate tumor cell glycolysis, resulting in the progression of thyroid carcinoma.
25656974 Data suggest that expression of MCT1 in intestinal mucosa can be altered by diet; here, expression of MCT1 is down-regulated in Caco-2 Cells by products of fermentation of dietary proteins by intestinal microbes.
25578492 Our findings suggest that SNPs in MCT1 and MCT2 genes may affect clinical outcomes and can be used to predict the response to adjuvant chemotherapy in NSCLC patients who received surgical treatment once validated in future study.
25492048 SNPs in MCT1 and MCT2 genes may affect clinical outcomes and can be used to predict the response to adjuvant chemotherapy in CRC patients who received surgical treatment
25456395 Overexpression of MCT1, MCT4, and CD147 predicts tumor progression in clear cell renal cell carcinoma.
25447800 MCT1 was up-regulated by exposure to DL-2-hydroxy-(4-methylthio)butanoic acid(HMTBA). Moreover, total monolayer MCT1 immunoreactivity increased 1.8-fold in HMTBA-supplemented cultures, this effect mainly being localised at the apical membrane.
25390740 exome sequencing in a patient with ketoacidosis and identified a homozygous frameshift mutation in the gene SLC16A1. Genetic analysis in 96 patients suspected of having ketolytic defects yielded seven additional inactivating mutations in MCT1
25371203 H(+)-coupled 5-oxoproline transport is mediated solely by SLC16A1 in astrocytes
25263481 The possible cooperative role of CD147 and MCT1 in determining cisplatin resistance.
25241983 We demonstrate, for the first time, that 3 different pHi regulators responsible for acid extruding, i.e. NHE and NBC, and MCT, are functionally co-existed in cultured radial artery smooth muscle cells.
25225794 We provide novel information of MCT1 as a candidate marker for prognostic stratification in NSCLC.
25068893 Data indicate that pteridine showed substantial anticancer activity in monocarboxylate transporter 1 (MCT1)-expressing Raji lymphoma cells.
24858043 Study demonstrated that PTEN loss and MCT-1 induction synergistically promoted the neoplastic multinucleation via the Src/p190B signaling activation.
24797797 These results indicate there are no additional benefits of IHT when compared to similar normoxic training. Hence, the addition of the hypoxic stimulus on anaerobic performance or MCT expression after a three-week training period is ineffective.
24708341 T-allele frequency was significantly higher among swimmers compared with runners.
24486553 Both L- and D-CysNO also inhibited cellular pyruvate uptake and caused S-nitrosation of thiol groups on monocarboxylate transporter 1, a proton-linked pyruvate transporter
24485392 The findings indicated that theMCT1 TT genotype was overrepresented in sprint/power athletes compared to both endurance athletes and non-athlete controls.
24338019 Coexpression of CAIV with MCT1 and MCT4 resulted in a significant increase in MCT transport activity.
24277449 Small cell lung cancer patients with tumors expressing MCT1 and lacking in MCT4 are most likely to respond to the antineoplastic agent AZD3965.
24166504 Study identifies the mitochondrion as a glucose sensor promoting tumor cell migration, MCT1 is also revealed as a transducer of this response, providing a new rationale for the use of MCT1 inhibitors in cancer.
24013424 MCT1 is an efficient lactate exporter in MM cells and plays a role in tumor growth within an acidic microenvironment.
24012639 MCT1 inhibition and or gene knockdown has antitumor potential associated with the nuclear factor kappa B pathway.
23628675 MCT1 gene A1470T polymorphism is associated with endurance athlete status and blood lactate level after intensive exercise.
23574725 MCT1 and MCT4 biomarkers were employed to determine the metabolic state of proliferative cancer cells.
23187830 Combined application of GLUT-1, MCT-1, and MCT-4 immunohistochemistry might be useful in differentiating malignant pleural mesothelioma from reactive mesothelial hyperplasia.
23073708 Data suggest that MCT1 is expressed in insulin-secreting cells; overexpression of MCT1 insulin-secreting cells (1 patient versus 3 organ donors) can possibly lead to exercise-induced hyperinsulinaemic hypoglycemia. [CASE REPORT]
22516692 The data suggested that MCT1 polymorphism influenced lactate transport across sarcolemma in males but not in females.
22428047 The lactate transporter monocarboxylate transporter 1 (MCT1) is the main regulator of HIF-1 activation by lactate in endothelial cells.
22281667 Co-expression of monocarboxylate transporter 1 (MCT1) and its chaperone (CD147) is associated with low survival in patients with gastrointestinal stromal tumors.
22184616 our findings identify MCT1 as a target for p53 repression and they suggest that MCT1 elevation in p53-deficient tumors allows them to adapt to metabolic needs by facilitating lactate export or import depending on the glucose availability.
21987487 Reduced SLC16A1 is associated with impaired butyrate oxidation in ulcerative colitis.
21930917 CD147 subunit of lactate/H+ symporters MCT1 and hypoxia-inducible MCT4 is critical for energetics and growth of glycolytic tumors.
21870331 both MCT1 and CD147, but not MCT4, were associated with GLUT1 and CAIX expression in a large series of invasive breast carcinoma samples
21787388 Data show that a significant increase of MCT2 and MCT4 expression in the cytoplasm of tumour cells and a significant decrease in both MCT1 and CD147 expression in prostate tumour cells was observed when compared to normal tissue.
21646425 miR-29a, miR-29b selectively target MCT1 3'UTR ; the miR-29 isoforms are highly expressed in islets and contribute to silencing Mct1 in beta cells; miR-29 isoforms contribute to beta-cell-specific silencing of the MCT1 transporter and may affect insulin release
21306479 We found that the expression of the monocarboxylate transporters MCT1 and MCT4, but not MCT5, in human lung cancer cell lines was significantly correlated with invasiveness
21081165 Loss of MCT1 on brain microvessels is mechanistically involved in the pathophysiology of drug-resistant temporal lobe epilepsy; re-expression of MCT1 may represent a novel therapeutic approach for this disease.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20636790 results provide evidence for a prognostic value of MCT1 in breast carcinoma
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20501436 Increased MCT1 association with CD147 at the apical membrane in response to somatostatin (SST) is p38 MAP kinase dependent and underlies the stimulatory effects of SST on butyrate uptake in human intestinal epithelial cells.
20454640 MCT1, MCT2, and MCT4 protein expression in breast, colon, lung, and ovary neoplasms, as well as CD147 and CD44, were analysed.
20035863 Monocarboxylic acid transporter 1 was expressed in the human corneal epithelium at mRNA and protein levels.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19905008 close correlation between the [Ca2+](in) level and pH(in), and NHEs were involved with the MCT mediated uptake process
19898482 Observational study of gene-disease association. (HuGE Navigator)
19881260 the -363-855T>C is a novel mutation. The 1282G>A (Val(428)Ile) is a novel SNP and was found as heterozygotic in 4 subjects. The 1470T>A (Asp(490)Glu) was found to be a common polymorphism in this study.
19881260 Observational study of genotype prevalence. (HuGE Navigator)
19876643 Data suggest that hypoxia increases lactate release from adipocytes and modulates MCT expression in a type-specific manner, with MCT1 and MCT4, but not MCT2 expression, being hypoxia-inducible transcription factor-1 (HIF-1) dependent.
19850519 carriers of the A1470T polymorphism in the MTC1 (monocarboxylate transporter 1) gene exhibit a worse lactate transport capability
19427019 miR-124 is frequently down-regulated in medulloblastoma and is a negative regulator of SLC16A1.
19033663 MCT1 was found to be expressed by an array of primary human tumors, we suggest that MCT1 inhibition has clinical antitumor potential.
19033536 PKC-zeta dependent stimulation of the human MCT1 promoter involves transcription factor AP2.
18832090 Report effects of high-intensity training on muscle MCT1/4 and postexercise recovery of muscle lactate and hydrogen ions in women.
18539591 the effective movement of H(+) into the bulk cytosol is increased by CAII, thus slowing the dissipation of the H(+) gradient across the cell membrane, which drives MCT1 activity
18188595 Expression of MCT1 and MCT4 showed a significant gain in plasma membranes of colorectal neoplasms.
18079261 In obesity, MCT1 expression appears linked both to changes in oxidative parameters and to changes in visceral adipose tissue content.
17701893 These studies show that promoter-activating mutations in exercise-induced hyperinsulinism induce SLC16A1 expression in beta cells, permitting pyruvate uptake and pyruvate-stimulated insulin release despite ensuing hypoglycemia.
17182800 DL-2-Hydroxy-(4-methylthio)butanoic acid is transported into the colonic cancer cell line cell membrane by a transport mechanissm involving MCT1.
17082373 A single bout of high-intensity exercise decreased both MCT relative abundance (MCT1 and MCT4) in membrane preparations.
17016429 Targeting the Map kinase signal transduction cascademay provide a potential therapeutic approach in lymphomas and related malignancies that exhibit high levels of the MCT-1 protein.
16441976 demonstrated greater activity of the RBC monocarboxylate cotransporter MCT-1, lower RBC deformability and impaired hematological indices in sickle cell trait (SCT) carriers compared to control subjects
16408234 this study shows conflicting adaptations in MCT1 and MCT4 protein and mRNA levels following training, which may indicate post-transcriptional regulation of MCT expression in human muscle.
16403470 Monocarboxylate transporter MCT1 is strongly expressed by glial cells often associated with blood vessels that were identified as astrocytes. (Monocarboxylate transporter MCT1)
16370372 The inhibition of MCT1 during T lymphocyte activation results in selective and profound inhibition of the extremely rapid phase of T cell division essential for an effective immune response.
16150873 studies demonstrate inhibition of MCT1-mediated butyrate uptake in Caco-2 cells in response to enteropathogenic Escherichia coli infection
16136905 MCT1 gene plays an important role in pHi regulation, lactate transport and cell growth in tumor cells.
15901598 Distinct MCT isoforms may be involved in short-chain fatty acid transport across the apical or basolateral membranes in polarized colonic epithelial cells.
15804185 MCT1 is functionally active and is the only MCT isoform involved in the apical uptake of monocarboxylates by retinal pigmented epithelial ARPE-19 cells
15765403 These results show the importance of MCT1 to the ability of butyrate to induce cell-cycle arrest and differentiation, and suggest fundamental differences in the mechanisms by which butyrate modulates specific aspects of cell function.
15135232 studies demonstrate that the opposing plasma membranes of human syncytiotrophoblast are polarized with respect to both monocarboxylate transporter MCT1 and MCT4 activity and expression
14724187 MCT1 content in skeletal muscle in Type 2 diabetes is lower compared with healthy men. Strength training increases MCT1 content in healthy men and in Type 2, thus normalizing the content in Type 2.
12949353 MCT mediates biotin uptake in human lymphoid cells.
12759536 MCT1 is involved in cellular transportation of butyrate, which induces cellular differentiation. Down-regulation is suggested to be involved in human breast cancers.
12479094 MCT1 and NHE1 genes play important regulation roles in proliferation and growth of tumor cells, probably by affecting pHi.
11953883 Carcinoma samples displaying reduced levels of MCT1 were found to express the high affinity glucose transporter, GLUT1, suggesting that there is a switch from butyrate to glucose as an energy source in colonic epithelia during transition to malignancy
11944921 the structural organization of the human MCT1 gene and 5'-flanking region which contains potential binding sites for a variety of transcription factors with known association with butyrate's action in the colon
11882670 substrate-induced regulation of human colonic MCT1. The basis of this regulation is a butyrate-induced increase in mRNA abundance, resulting from the dual control of gene transcription and stability of the transcript

AA Sequence

MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY      1 - 70
GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY     71 - 140
KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS    141 - 210
KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP    211 - 280
LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS    281 - 350
TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK    351 - 420
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD    421 - 490
GGPKEEESPV                                                                491 - 500
//

Text Mined References (125)

PMID Year Title
26876179 2016 MCT1 Modulates Cancer Cell Pyruvate Export and Growth of Tumors that Co-express MCT1 and MCT4.
26779534 2015 Prognostic Indications of Elevated MCT4 and CD147 across Cancer Types: A Meta-Analysis.
26615136 2015 Mitochondrial Metabolism as a Treatment Target in Anaplastic Thyroid Cancer.
26595136 2015 Variants of the Solute Carrier SLC16A1 Gene (MCT1) Associated With Metabolic Responses During a Long-Graded Test in Road Cyclists.
26539827 2015 A Pilot Proteogenomic Study with Data Integration Identifies MCT1 and GLUT1 as Prognostic Markers in Lung Adenocarcinoma.
26045776 2015 MCT1 promotes the cisplatin-resistance by antagonizing Fas in epithelial ovarian cancer.
26024713 2015 Recombinant Multivalent EMMPRIN Extracellular Domain Induces U937 Human Leukemia Cell Apoptosis by Downregulation of Monocarboxylate Transporter 1 and Activation of Procaspase-9.
25957999 2015 Optimisation of immunofluorescence methods to determine MCT1 and MCT4 expression in circulating tumour cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755717 2015 RNA interference targeting CD147 inhibits the proliferation, invasiveness, and metastatic activity of thyroid carcinoma cells by down-regulating glycolysis.
25656974 2015 Down-regulation of monocarboxylate transporter 1 (MCT1) gene expression in the colon of piglets is linked to bacterial protein fermentation and pro-inflammatory cytokine-mediated signalling.
25578492 2015 Genetic variations in monocarboxylate transporter genes as predictors of clinical outcomes in non-small cell lung cancer.
25492048 2015 Polymorphisms of monocarboxylate transporter genes are associated with clinical outcomes in patients with colorectal cancer.
25456395 2015 Expression of lactate/H? symporters MCT1 and MCT4 and their chaperone CD147 predicts tumor progression in clear cell renal cell carcinoma: immunohistochemical and The Cancer Genome Atlas data analyses.
25447800 2014 Monocarboxylate transporter 1 is up-regulated in Caco-2 cells by the methionine precursor DL-2-hydroxy-(4-methylthio)butanoic acid.
25390740 2014 Monocarboxylate transporter 1 deficiency and ketone utilization.
25371203 2015 Functional characterization of 5-oxoproline transport via SLC16A1/MCT1.
25263481 2015 CD147 and MCT1-potential partners in bladder cancer aggressiveness and cisplatin resistance.
25241983 2014 Functional characterization of intracellular pH regulators responsible for acid extrusion in human radial artery smooth muscle cells.
25225794 2014 Monocarboxylate transporters 1-4 in NSCLC: MCT1 is an independent prognostic marker for survival.
25068893 2014 Synthesis and structure-activity relationships of pteridine dione and trione monocarboxylate transporter 1 inhibitors.
24858043 2014 MCT-1 expression and PTEN deficiency synergistically promote neoplastic multinucleation through the Src/p190B signaling activation.
24797797 2014 Effects of intermittent training on anaerobic performance and MCT transporters in athletes.
24708341 2015 Differences in MCT1 A1470T polymorphism prevalence between runners and swimmers.
24486553 2014 S-Nitrosation of monocarboxylate transporter 1: inhibition of pyruvate-fueled respiration and proliferation of breast cancer cells.
24485392 2015 MCT1 A1470T: a novel polymorphism for sprint performance?
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
24338019 2014 Intracellular and extracellular carbonic anhydrases cooperate non-enzymatically to enhance activity of monocarboxylate transporters.
24277449 2014 Activity of the monocarboxylate transporter 1 inhibitor AZD3965 in small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166504 2014 Glucose deprivation increases monocarboxylate transporter 1 (MCT1) expression and MCT1-dependent tumor cell migration.
24013424 2013 CD147 regulates the expression of MCT1 and lactate export in multiple myeloma cells.
24012639 2014 Downregulation of MCT1 inhibits tumor growth, metastasis and enhances chemotherapeutic efficacy in osteosarcoma through regulation of the NF-?B pathway.
23816619 2013 The centriolar satellite protein SSX2IP promotes centrosome maturation.
23628675 2014 A common polymorphism of the MCT1 gene and athletic performance.
23574725 2013 Cancer metabolism, stemness and tumor recurrence: MCT1 and MCT4 are functional biomarkers of metabolic symbiosis in head and neck cancer.
23187830 2013 Expression and role of GLUT-1, MCT-1, and MCT-4 in malignant pleural mesothelioma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23073708 2013 Association of exercise-induced hyperinsulinaemic hypoglycaemia with MCT1-expressing insulinoma.
22516692 2012 Influence of the MCT1-T1470A polymorphism (rs1049434) on blood lactate accumulation during different circuit weight trainings in men and women.
22428047 2012 Targeting the lactate transporter MCT1 in endothelial cells inhibits lactate-induced HIF-1 activation and tumor angiogenesis.
22281667 2012 Co-expression of monocarboxylate transporter 1 (MCT1) and its chaperone (CD147) is associated with low survival in patients with gastrointestinal stromal tumors (GISTs).
22184616 2012 Regulation of monocarboxylate transporter MCT1 expression by p53 mediates inward and outward lactate fluxes in tumors.
22162139 2012 The monocarboxylate transporter family--role and regulation.
21987487 2012 Impaired butyrate oxidation in ulcerative colitis is due to decreased butyrate uptake and a defect in the oxidation pathway.
21930917 2011 CD147 subunit of lactate/H+ symporters MCT1 and hypoxia-inducible MCT4 is critical for energetics and growth of glycolytic tumors.
21870331 2011 GLUT1 and CAIX expression profiles in breast cancer correlate with adverse prognostic factors and MCT1 overexpression.
21787388 2011 Monocarboxylate transporter 4 (MCT4) and CD147 overexpression is associated with poor prognosis in prostate cancer.
21646425 2011 miR-29a and miR-29b contribute to pancreatic beta-cell-specific silencing of monocarboxylate transporter 1 (Mct1).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21306479 2011 Monocarboxylate transporters 1 and 4 are involved in the invasion activity of human lung cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21081165 2011 Monocarboxylate transporter 1 is deficient on microvessels in the human epileptogenic hippocampus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20636790 2010 Monocarboxylate transporter 1 is up-regulated in basal-like breast carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20501436 2009 Mechanisms underlying modulation of monocarboxylate transporter 1 (MCT1) by somatostatin in human intestinal epithelial cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20454640 2010 Expression of monocarboxylate transporters 1, 2, and 4 in human tumours and their association with CD147 and CD44.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20035863 2010 Monocarboxylate transport in human corneal epithelium and cell lines.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19905008 2010 The involvement of intracellular calcium in the MCT-mediated uptake of lactic acid by HeLa cells.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19881260 2009 Genetic variations in the MCT1 (SLC16A1) gene in the Chinese population of Singapore.
19876643 2010 Hypoxia stimulates lactate release and modulates monocarboxylate transporter (MCT1, MCT2, and MCT4) expression in human adipocytes.
19850519 2010 MCT1 genetic polymorphism influence in high intensity circuit training: a pilot study.
19427019 2009 miR-124 is frequently down-regulated in medulloblastoma and is a negative regulator of SLC16A1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19033663 2008 Targeting lactate-fueled respiration selectively kills hypoxic tumor cells in mice.
19033536 2009 PKC-dependent stimulation of the human MCT1 promoter involves transcription factor AP2.
18832090 2008 Effects of high-intensity training on muscle lactate transporters and postexercise recovery of muscle lactate and hydrogen ions in women.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18539591 2008 Nonenzymatic proton handling by carbonic anhydrase II during H+-lactate cotransport via monocarboxylate transporter 1.
18188595 2008 Increased expression of monocarboxylate transporters 1, 2, and 4 in colorectal carcinomas.
18079261 2008 Effect of weight loss on lactate transporter expression in skeletal muscle of obese subjects.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17701893 2007 Physical exercise-induced hypoglycemia caused by failed silencing of monocarboxylate transporter 1 in pancreatic beta cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17182800 2007 Monocarboxylate transporter 1 mediates DL-2-Hydroxy-(4-methylthio)butanoic acid transport across the apical membrane of Caco-2 cell monolayers.
17127621 The role of charged residues in the transmembrane helices of monocarboxylate transporter 1 and its ancillary protein basigin in determining plasma membrane expression and catalytic activity.
17082373 2007 High-intensity exercise acutely decreases the membrane content of MCT1 and MCT4 and buffer capacity in human skeletal muscle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17016429 2007 Phosphorylation of MCT-1 by p44/42 MAPK is required for its stabilization in response to DNA damage.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16441976 2005 Does higher red blood cell (RBC) lactate transporter activity explain impaired RBC deformability in sickle cell trait?
16408234 2006 The effects of short-term sprint training on MCT expression in moderately endurance-trained runners.
16403470 2006 Expression of the monocarboxylate transporter MCT1 in the adult human brain cortex.
16370372 2005 Monocarboxylate transporter MCT1 is a target for immunosuppression.
16150873 2006 Enteropathogenic Escherichia coli inhibits butyrate uptake in Caco-2 cells by altering the apical membrane MCT1 level.
16136905 2001 [The effect of monocarboxylate transporter gene on the regulation of pHi and growth character in cancer cells].
15917240 2005 Basigin (CD147) is the target for organomercurial inhibition of monocarboxylate transporter isoforms 1 and 4: the ancillary protein for the insensitive MCT2 is EMBIGIN (gp70).
15901598 2005 Expression and membrane localization of MCT isoforms along the length of the human intestine.
15804185 Functional activity of a monocarboxylate transporter, MCT1, in the human retinal pigmented epithelium cell line, ARPE-19.
15765403 2005 The human colonic monocarboxylate transporter Isoform 1: its potential importance to colonic tissue homeostasis.
15505343 2004 Presence and localization of three lactic acid transporters (MCT1, -2, and -4) in separated human granulocytes, lymphocytes, and monocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15135232 2004 Polarized lactate transporter activity and expression in the syncytiotrophoblast of the term human placenta.
14724187 2004 Effects of strength training on muscle lactate release and MCT1 and MCT4 content in healthy and type 2 diabetic humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949353 2003 Monocarboxylate transporter 1 mediates biotin uptake in human peripheral blood mononuclear cells.
12759536 2003 Reduced expression of GNA11 and silencing of MCT1 in human breast cancers.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12657613 2003 Polarized expression of monocarboxylate transporters in human retinal pigment epithelium and ARPE-19 cells.
12479094 2002 [Effect of co-inhibition of MCT1 gene and NHE1 gene on proliferation and growth of human lung adenocarcinoma cells].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11953883 2002 Molecular changes in the expression of human colonic nutrient transporters during the transition from normality to malignancy.
11944921 2002 The human monocarboxylate transporter, MCT1: genomic organization and promoter analysis.
11882670 2002 Substrate-induced regulation of the human colonic monocarboxylate transporter, MCT1.
11820324 2001 The expression of lactate transporters (MCT1 and MCT4) in heart and muscle.
10921872 2000 CD147 is tightly associated with lactate transporters MCT1 and MCT4 and facilitates their cell surface expression.
10590411 2000 Mutations in MCT1 cDNA in patients with symptomatic deficiency in lactate transport.
10562613 1999 Cardiac and skeletal muscle mitochondria have a monocarboxylate transporter MCT1.
10471310 1999 Helix 8 and helix 10 are involved in substrate recognition in the rat monocarboxylate transporter MCT1.
9824713 1998 Identification and characterization of a monocarboxylate transporter (MCT1) in pig and human colon: its potential to transport L-lactate as well as butyrate.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8124722 1994 Molecular characterization of a membrane transporter for lactate, pyruvate, and other monocarboxylates: implications for the Cori cycle.
7835905 1994 cDNA cloning of the human monocarboxylate transporter 1 and chromosomal localization of the SLC16A1 locus to 1p13.2-p12.
7273846 1981 The glucose-lactic acid cycle and gluconeogenesis.
1429658 1992 cDNA cloning of MEV, a mutant protein that facilitates cellular uptake of mevalonate, and identification of the point mutation responsible for its gain of function.