Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.93
PubTator Score 8.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis 1.086 9.1e-03
astrocytoma 1.500 1.6e-02
cutaneous lupus erythematosus 2.400 3.9e-04
cystic fibrosis 1.100 5.4e-03
interstitial cystitis 1.200 3.6e-03
invasive ductal carcinoma 1.149 4.9e-04
juvenile dermatomyositis 1.059 1.5e-09
lung carcinoma -1.800 8.6e-22
mucosa-associated lymphoid tissue lympho... 1.856 4.3e-02
non-small cell lung cancer -1.194 9.3e-11
psoriasis 1.600 1.3e-04
subependymal giant cell astrocytoma 1.473 2.8e-02

Gene RIF (1)

AA Sequence

MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYLNSTNFNWTGE      1 - 70
QATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLG     71 - 140
PACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLGRDATRRFFNWFYWSINLGA    141 - 210
VLSLLVVAFIQQNISFLLGYSIPVGCVGLAFFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRH    211 - 280
SARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIF    281 - 350
PANPANISVALRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT    351 - 420
SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRS    421 - 490
MQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIA    491 - 560
GRYERASQGPASHSRFSRDRG                                                     561 - 581
//

Text Mined References (10)

PMID Year Title