Property Summary

NCBI Gene PubMed Count 40
PubMed Score 145.11
PubTator Score 81.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
urothelial carcinoma -1.400 2.0e-02
malignant mesothelioma -1.200 2.7e-04
astrocytic glioma 1.900 4.8e-02
oligodendroglioma 1.200 4.9e-02
cutaneous lupus erythematosus 1.500 3.1e-03
osteosarcoma -2.873 1.5e-10
sonic hedgehog group medulloblastoma -3.000 2.7e-07
periodontitis 1.300 8.8e-23
atypical teratoid/rhabdoid tumor -2.200 6.3e-06
glioblastoma -1.300 3.6e-02
medulloblastoma, large-cell -2.900 1.5e-03
primitive neuroectodermal tumor -1.500 3.1e-02
tuberculosis 1.600 2.5e-04
non-small cell lung cancer -1.788 2.4e-12
intraductal papillary-mucinous adenoma (... -1.200 1.5e-03
lung cancer -3.600 4.5e-06
Breast cancer -2.500 2.5e-02
lung adenocarcinoma -1.700 3.7e-10
pediatric high grade glioma -1.300 7.2e-03
posterior fossa group B ependymoma 1.700 2.5e-08
nasopharyngeal carcinoma -1.600 5.7e-06
lung carcinoma -2.400 1.5e-26
spina bifida -2.052 3.3e-02
ductal carcinoma in situ 1.500 2.2e-02
invasive ductal carcinoma 1.100 2.8e-02
pituitary cancer -1.300 3.3e-03

 GWAS Trait (1)

Gene RIF (33)

PMID Text
26168863 PEPT2 is functionally expressed in H441 cells, making the cell line a good in vitro model to study PEPT2 function and its regulation in human distal lung.
25965825 In vitro study displayed different response to sorafenib depending on the genotype of SLC15A2.
25531100 OSR1 has the capacity to downregulate the peptide transporters PEPT1 and PEPT2 by decreasing the carrier protein abundance in the cell membrane
25514583 This study showed that ALAD2 and hPEPT2*2 may be valuable markers of risk, and indicate novel mechanisms of lead-induced neurotoxicity
23934551 JAK3 is a powerful regulator of the peptide transporters PEPT1 and PEPT2.
22950754 LNCaP expresses high levels of PEPT2 and PHT1.
21366347 PEPT1,PEPT2, PHT1, and PHT2 are expressed in human nasal epithelium.
21327641 ALAD2 and hPEPT2*2 polymorphisms may exaggerate Pb blood burden in boys.
20868728 PepT2-mRNA is expressed in U373-MG and glial cells but showed no regulation of PepT2-mRNA expression in both cell types.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20406817 Data identify Drosophila Yin and PEPT2 as evolutionarily conserved phagosome-associated transporters.
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20067523 anserine is recognized by the proton-coupled peptide transporters PEPT1 and PEPT2 with medium affinity. Anserine is able to displace other substrates from the transport process.
19898482 Observational study of gene-disease association. (HuGE Navigator)
19723536 Higher blood lead burden in children with the PEPT2*2 mutation may suggest that this common genetic variant is a biomarker of increased vulnerability to the neurotoxic effects of lowest level lead exposure.
19723536 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19246733 hPEPT1 and hPEPT2 are unlikely to contribute to clinically important drug interactions in humans.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18766334 PEPT2 polymorphism distributions differ significantly between Chinese, Malay and Asian Indian populations. Cephalexin pharmacokinetics were not different between Chinese and Asian Indians.
18766334 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18762712 the expression/activity of PEPT2 may be a critical factor in the modulation of opioidergic neurotransmission in vivo.
18713951 there are no major differences in the substrate recognition pattern of hPEPT1 and rPEPT2 with regard to the ACE inhibitors tested.
18668438 PEPT2 to be the dominant transporter for the reabsorption of di- and tripeptides and its pharmacological substrates in the organism, and for the removal of these substrates from the cerebrospinal fluid
18474668 PEPT2 plays a vital role in microbial recognition by nucleotide-binding oligomerization domain (NOD)-like receptor proteins
18367661 does not operate as a cotransporter in tissues where there is little or no pH gradient, such as choroid plexus, lung, or mammary gland
16738539 PEPT2-PDZK1 interaction thus plays a physiologically important role in both oligopeptide handling as well as peptide-like drug transport in the human kidney
15981923 functionalities of PEPT1 and PEPT2 were largely conserved in terms of glycylsarcosine uptake kinetics and inhibitor specificity
15626774 expression and function of the peptide transporter PepT2 (SLC15A2) in differentiated primary cultures of upper airway lung epithelia
15282265 polymorphisms in the gene encoding hPEPT2 can alter substrate transport and therefore could affect drug disposition in vivo
15020234 Amino acid substitution at Arg57 in PEPT2 causes a complete loss of transport function.
12579467 expression, localization and functional aspects of this protein in the normal respiratory tract and in cystic fibrosis
11944083 the two identified aminoterminal regions in mammalian peptide carriers play an important role in determining the substrate affinity and also other characteristic features of the two transporter subtypes.

AA Sequence

MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSYYGMKAVLILY      1 - 70
FLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQV     71 - 140
VHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQ    141 - 210
CFGEDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHW    211 - 280
LDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPL    281 - 350
LVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN    351 - 420
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLV    421 - 490
IREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVGEDYGVSAYRTVQRGEYPAVH    491 - 560
CRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGL    561 - 630
EFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVK    631 - 700
TEDMRGPADKHIPHIQGNMIKLETKKTKL                                             701 - 729
//

Text Mined References (41)

PMID Year Title
26168863 2015 Functional Expression of PEPT2 in the Human Distal Lung Epithelial Cell Line NCl-H441.
25965825 2015 SLC15A2 genomic variation is associated with the extraordinary response of sorafenib treatment: whole-genome analysis in patients with hepatocellular carcinoma.
25531100 2014 Downregulation of peptide transporters PEPT1 and PEPT2 by oxidative stress responsive kinase OSR1.
25514583 ?-Aminolevulinic acid dehydratase single nucleotide polymorphism 2 (ALAD2) and peptide transporter 2*2 haplotype (hPEPT2*2) differently influence neurobehavior in low-level lead exposed children.
23934551 2013 Effect of Janus kinase 3 on the peptide transporters PEPT1 and PEPT2.
22950754 2013 Expression profile and functional activity of peptide transporters in prostate cancer cells.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21366347 2011 Proton-coupled oligopeptide transporter (POT) family expression in human nasal epithelium and their drug transport potential.
21327641 2011 ?-Aminolevulinic acid dehydratase single nucleotide polymorphism 2 and peptide transporter 2*2 haplotype may differentially mediate lead exposure in male children.
20868728 2010 U373-MG cells express PepT2 and accumulate the fluorescently tagged dipeptide-derivative ?-Ala-Lys-N(?)-AMCA.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20406817 2010 Identification of Drosophila Yin and PEPT2 as evolutionarily conserved phagosome-associated muramyl dipeptide transporters.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20067523 2010 The bioactive dipeptide anserine is transported by human proton-coupled peptide transporters.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19723536 2009 Polymorphisms of delta-aminolevulinic acid dehydratase (ALAD) and peptide transporter 2 (PEPT2) genes in children with low-level lead exposure.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19246733 2009 Lack of interaction between the peptidomimetic substrates captopril and cephradine.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18766334 2009 Interethnic differences of PEPT2 (SLC15A2) polymorphism distribution and associations with cephalexin pharmacokinetics in healthy Asian subjects.
18762712 2008 Stimulation of Na+/Cl--coupled opioid peptide transport system in SK-N-SH cells by L-kyotorphin, an endogenous substrate for H+-coupled peptide transporter PEPT2.
18713951 2008 Transport of angiotensin-converting enzyme inhibitors by H+/peptide transporters revisited.
18668438 2008 Peptide transporters and their roles in physiological processes and drug disposition.
18474668 2008 Bacterial peptide recognition and immune activation facilitated by human peptide transporter PEPT2.
18367661 2008 Molecular mechanism of dipeptide and drug transport by the human renal H+/oligopeptide cotransporter hPEPT2.
16738539 2006 The PDZ domain protein PDZK1 interacts with human peptide transporter PEPT2 and enhances its transport activity.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15981923 Comparison of human and monkey peptide transporters: PEPT1 and PEPT2.
15626774 2005 Functional characterization of the peptide transporter PEPT2 in primary cultures of human upper airway epithelium.
15282265 2004 Genetic variants of the human H+/dipeptide transporter PEPT2: analysis of haplotype functions.
15020234 2004 Genetic variant Arg57His in human H+/peptide cotransporter 2 causes a complete loss of transport function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12905028 2004 The proton oligopeptide cotransporter family SLC15 in physiology and pharmacology.
12579467 2003 [Expression, localization and functional aspects of the peptide transporter PEPT2 in the normal respiratory tract and in cystic fibrosis].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388627 2002 Transporter gene expression in lactating and nonlactating human mammary epithelial cells using real-time reverse transcription-polymerase chain reaction.
11944083 2002 Importance of a small N-terminal region in mammalian peptide transporters for substrate affinity and function.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7756356 1995 Molecular cloning of PEPT 2, a new member of the H+/peptide cotransporter family, from human kidney.