Property Summary

NCBI Gene PubMed Count 28
PubMed Score 138.40
PubTator Score 87.22

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.0e-04
ovarian cancer 1.300 7.7e-10

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
26927669 UT2 is a negative regulator shared across STAT3 and mTORC2 signaling cascades, functioning as a tumor suppressor in hematologic malignancies driven by those pathways.
25298341 Studies indicate that the cell signaling pathway for vasopressin-mediated urea transporters phosphorylation and activity involves two cAMP-dependent signaling pathways.
25298340 Studies indicate that osmotic diuresis, where urea concentrations are low, can prompt an increase in urea transporter abundance.
25298338 Studies indicate that the urea transporter SLC14a2, the UT-A group, was originally isolated from kidney inner medulla.
20797394 HUT2 gene may play a certain role in developing metabolic syndrome and its related traits in Asian population.
20797394 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17344938 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17344938 polymorphisms in the SLC14A2 gene can predict the antihypertensive efficacy of nifedipine GITS (gastrointestinal therapeutic system)
17264986 This review summarizes the published work that has accrued on the structure and regulation of these genes.
16480766 results provide new evidences that suggest the involvement of AQP9 and UT-A in the urea excretion mechanism across human term placenta from mother to fetus in physiological conditions
15189812 a novel UT-A urea transporter; the transcript contains a novel 129-bp exon, exon 5a, which, as a result of alternative splicing, introduces a unique 19-aa segment and a stop codon.
11590132 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSHIVKIEKLNER      1 - 70
SKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQVMFINNPLSGLI     71 - 140
IFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASGLHGYNGMLVGLLMAVFSEKLDYYWWLLFPV    141 - 210
TFTAMSCPVLSSALNSIFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMP    211 - 280
LLLQAIPVGVGQVYGCDNPWTGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNC    281 - 350
VLSCIAIGGMFYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIF    351 - 420
RLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRS    421 - 490
KVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYI    491 - 560
TGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQNPWWAISGCLGTIMSTLTAL    561 - 630
ILSQDKSAIAAGFHGYNGVLVGLLMAVFSDKGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTL    631 - 700
PFNITVTLYLAATGHYNLFFPTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIA    701 - 770
LFISSPLICLHAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALF    771 - 840
AAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYLSQERNRRASI    841 - 910
ITKYQAYDVS                                                                911 - 920
//

Text Mined References (31)

PMID Year Title
26927669 2016 Endogenous transmembrane protein UT2 inhibits pSTAT3 and suppresses hematological malignancy.
25298341 2014 Biochemical properties of urea transporters.
25298340 2014 Expression of urea transporters and their regulation.
25298338 2014 Genes and proteins of urea transporters.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23620790 2013 CBAP functions as a novel component in chemokine-induced ZAP70-mediated T-cell adhesion and migration.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22693459 2012 Six novel susceptibility Loci for early-onset androgenetic alopecia and their unexpected association with common diseases.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20797394 2010 Genetic variants of human urea transporter-2 are associated with metabolic syndrome in Asian population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
17702749 2007 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein.
17344938 Genetic polymorphisms of the urea transporter gene are associated with antihypertensive response to nifedipine GITS.
17264986 2006 Genomic organization of the mammalian SLC14a2 urea transporter genes.
16480766 Functional and molecular expression of AQP9 channel and UT-A transporter in normal and preeclamptic human placentas.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189812 2004 Characterization of a human colonic cDNA encoding a structurally novel urea transporter, hUT-A6.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12952854 2003 Expression of urea transporters in potassium-depleted mouse kidney.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590132 2001 Genetic variation in the human urea transporter-2 is associated with variation in blood pressure.
11502588 2001 Cloning and characterization of the human urea transporter UT-A1 and mapping of the human Slc14a2 gene.
11399654 2001 97- and 117-kDa forms of collecting duct urea transporter UT-A1 are due to different states of glycosylation.
8647271 1996 Molecular characterization of a new urea transporter in the human kidney.
7989337 1994 Cloning and functional expression of a urea transporter from human bone marrow cells.