Property Summary

NCBI Gene PubMed Count 12
PubMed Score 70.93
PubTator Score 18.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8297 1.3e-08
non primary Sjogren syndrome sicca 861 2.1e-02
nephrosclerosis 314 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
lung cancer 4607 0.0 0.6
Disease Target Count Z-score Confidence
Diastrophic dysplasia 21 4.003 2.0
Nephrolithiasis 55 3.502 1.8

Gene RIF (5)

AA Sequence

MKFFSYILVYRRFLFVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTALLPSLMLPMFG      1 - 70
IMPSKKVASAYFKDFHLLLIGVICLATSIEKWNLHKRIALKMVMMVGVNPAWLTLGFMSSTAFLSMWLSN     71 - 140
TSTAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTG    141 - 210
KISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSSTIGGLTTITGTSTNLIFAEYFNTRYPDCRCLN    211 - 280
FGSWFTFSFPAALIILLLSWIWLQWLFLGFNFKEMFKCGKTKTVQQKACAEVIKQEYQKLGPIRYQEIVT    281 - 350
LVLFIIMALLWFSRDPGFVPGWSALFSEYPGFATDSTVALLIGLLFFLIPAKTLTKTTPTGEIVAFDYSP    351 - 420
LITWKEFQSFMPWDIAILVGGGFALADGCEESGLSKWIGNKLSPLGSLPAWLIILISSLMVTSLTEVASN    421 - 490
PATITLFLPILSPLAEAIHVNPLYILIPSTLCTSFAFLLPVANPPNAIVFSYGHLKVIDMVKAGLGVNIV    491 - 560
GVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP                                       561 - 595
//

Text Mined References (12)

PMID Year Title