Property Summary

Ligand Count 13
NCBI Gene PubMed Count 116
PubMed Score 634.19
PubTator Score 285.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 6.4e-23
ovarian cancer 8520 1.5e-08
osteosarcoma 7950 3.3e-05
malignant mesothelioma 3232 1.8e-03
cutaneous lupus erythematosus 1057 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 4.6e-03
malignant mesothelioma 1.100 1.8e-03
osteosarcoma -1.034 3.3e-05
ovarian cancer 1.200 1.5e-08
psoriasis 1.900 6.4e-23

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (106)

AA Sequence

MAELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFCMRTFGYNTIDVVPTYEHY      1 - 70
ANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEGEAGTSSEKNPEEPVRFGWVK     71 - 140
GVMIRCMLNIWGVILYLRLPWITAQAGIVLTWIIILLSVTVTSITGLSISAISTNGKVKSGGTYFLISRS    141 - 210
LGPELGGSIGLIFAFANAVGVAMHTVGFAETVRDLLQEYGAPIVDPINDIRIIAVVSVTVLLAISLAGME    211 - 280
WESKAQVLFFLVIMVSFANYLVGTLIPPSEDKASKGFFSYRADIFVQNLVPDWRGPDGTFFGMFSIFFPS    281 - 350
ATGILAGANISGDLKDPAIAIPKGTLMAIFWTTISYLAISATIGSCVVRDASGVLNDTVTPGWGACEGLA    351 - 420
CSYGWNFTECTQQHSCHYGLINYYQTMSMVSGFAPLITAGIFGATLSSALACLVSAAKVFQCLCEDQLYP    421 - 490
LIGFFGKGYGKNKEPVRGYLLAYAIAVAFIIIAELNTIAPIISNFFLCSYALINFSCFHASITNSPGWRP    491 - 560
SFQYYNKWAALFGAIISVVIMFLLTWWAALIAIGVVLFLLLYVIYKKPEVNWGSSVQAGSYNLALSYSVG    561 - 630
LNEVEDHIKNYRPQCLVLTGPPNFRPALVDFVGTFTRNLSLMICGHVLIGPHKQRMPELQLIANGHTKWL    631 - 700
NKRKIKAFYSDVIAEDLRRGVQILMQAAGLGRMKPNILVVGFKKNWQSAHPATVEDYIGILHDAFDFNYG    701 - 770
VCVMRMREGLNVSKMMQAHINPVFDPAEDGKEASARVDPKALVKEEQATTIFQSEQGKKTIDIYWLFDDG    771 - 840
GLTLLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKR    841 - 910
FEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIG    911 - 980
RKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYCQ                                 981 - 1021
//

Text Mined References (130)

PMID Year Title