Property Summary

Ligand Count 4
NCBI Gene PubMed Count 71
PubMed Score 1033.90
PubTator Score 279.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Edema 81
Hypertensive disorder 56
Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Small intestine cancer 12 0.0 1.4

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis 1.560 2.4e-03
atypical teratoid / rhabdoid tumor 1.200 1.2e-04
Breast cancer 2.500 2.9e-02
chronic rhinosinusitis 1.070 2.4e-02
colon cancer 1.500 4.4e-02
cutaneous lupus erythematosus -1.500 2.9e-02
ductal carcinoma in situ 2.300 3.4e-02
ependymoma -1.200 9.2e-05
glioblastoma -1.100 9.1e-04
group 4 medulloblastoma -1.200 4.2e-02
intraductal papillary-mucinous adenoma (... 2.800 2.1e-03
intraductal papillary-mucinous carcinoma... 3.100 1.8e-03
intraductal papillary-mucinous neoplasm ... 3.200 1.1e-02
invasive ductal carcinoma 2.600 1.7e-02
lung cancer 2.400 6.3e-06
malignant mesothelioma -1.900 1.7e-07
medulloblastoma, large-cell 2.400 1.6e-04
ovarian cancer -1.300 3.4e-03
pancreatic cancer 1.200 7.3e-04
primary pancreatic ductal adenocarcinoma 1.570 3.1e-03
progressive supranuclear palsy -1.200 4.4e-02
psoriasis -1.300 5.9e-06
tuberculosis -1.200 6.5e-06

Gene RIF (53)

AA Sequence

MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEGPAAAGDGLGR      1 - 70
PLGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADGEASGESEPAKGSEEAKGRFR     71 - 140
VNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYL    141 - 210
RTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK    211 - 280
GVVKFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGG    281 - 350
GAYYLISRSLGPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVIL    351 - 420
LGISVAGMEWEAKAQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPDFREEETFFSV    421 - 490
FAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSVGSCVVRDATGNVNDTIVTEL    491 - 560
TNCTSAACKLNFDFSSCESSPCSYGLMNNFQVMSMVSGFTPLISAGIFSATLSSALASLVSAPKIFQALC    561 - 630
KDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAK    631 - 700
SPGWRPAFKYYNMWISLLGAILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNA    701 - 770
LQHSIRLSGVEDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA    771 - 840
KYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDA    841 - 910
FDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEE    911 - 980
DGKTATQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWLFDDGGLTLLIPYLLTTKKKWK    981 - 1050
DCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQ   1051 - 1120
DIADKMKEDEPWRITDNELELYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEAL   1121 - 1190
SKDLPPILLVRGNHQSVLTFYS                                                   1191 - 1212
//

Text Mined References (75)

PMID Year Title